KEGG   Chlorobium chlorochromatii: Cag_0888Help
Entry
Cag_0888          CDS       T00290                                 

Definition
iron-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
cch  Chlorobium chlorochromatii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cag_0888
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cag_0888
  Lipid metabolism
   00071 Fatty acid degradation
    Cag_0888
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cag_0888
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cag_0888
   00626 Naphthalene degradation
    Cag_0888
Enzymes [BR:cch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cag_0888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1218452..1219660)
Genome map
AA seq 402 aa AA seqDB search
MPSIPFSPFITLPLPELYCGAGTVKHLPELAARFGRTVLLITGKRALQQSGRLMALQAAM
QQGGLKLFHEVIEREPSPEIVNRVVAEYRQYGVEVVVAIGGGSVLDGGKAISGMLCYHEP
VERFIEGLPNMVPFDGRKVPFIAVPTTAGTGSEVTNNAVISRVGDNGFKRSLRHRALVPN
IAVVDPELMVGTPASLTIASGMDACTQLLEAYTSPFATPYTDAVALSGLNHFSRSFVAAC
GSGTNDVAVRGDVAYAACMSGVALANAGLGVVHGFASSVGGLIDIPHGVLCATLLYEATR
ENIEALRQLESNHPQLQKFSCAGSIMVRGVGMEVSSAPSIEEGCELLLALLEHWQERFNF
ARLQNYGLQLHHIPVLVQATRTKSNAVALSSTAMERILHNRL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgccatctattccattttcaccctttataaccttgcccttaccagaactctattgcggg
gcgggaaccgtcaaacatttgcctgagcttgcagcccgttttgggcgcacggtgttgttg
ataacgggtaaacgtgcgttacagcaatcggggcgtttgatggcgttgcaagctgcaatg
cagcagggaggtctcaagctcttccatgaggtgattgagcgtgagccttcgcccgaaatc
gtgaaccgtgtggttgccgagtatcgtcaatatggtgtggaggttgtggttgccattggt
ggagggagtgtgttggatggtggcaaggcaatttcgggaatgctctgttaccatgagcca
gtggagcgctttattgagggtttaccaaatatggtgccgtttgatgggcgtaaggtacct
tttattgccgtgccaactacggctggtacgggaagtgaggttaccaacaatgcggttatt
agccgagtaggagacaatggttttaagcgttcgttgcgccatcgggcattggtgccaaat
attgcggtagttgatcctgagttaatggtgggcacacctgccagtttaacaattgcatcg
ggtatggatgcttgtacgcagttgctggaggcttatacctcgccttttgcaacgccttat
accgatgctgtggcgttaagcgggctcaaccattttagtcgctcgtttgttgctgcatgt
ggcagtggcaccaatgatgttgccgtgcggggtgatgtagcttatgcagcatgtatgtcg
ggggtggcattggcaaatgcggggcttggcgtagtgcatggttttgcctcatccgttggg
ggacttattgatattccgcacggcgtattgtgcgcaacattgctttacgaagcaacgcgc
gaaaacattgaggcattgcgccaacttgagagcaaccatccgcaattgcaaaaatttagc
tgtgcgggaagcattatggtgcgtggcgttggtatggaggtttcgtcagcaccctcaatt
gaagagggttgcgagttattgcttgcgcttcttgagcattggcaggagagatttaatttt
gcccgtttacaaaactatggtttgcagttgcaccatattcctgtacttgtgcaagccacg
cgcaccaaaagcaatgccgtagcactctcatcaacagctatggaacgcatattgcacaat
cgcttgtag

DBGET integrated database retrieval system