KEGG   Chlorobium chlorochromatii: Cag_0983Help
Entry
Cag_0983          CDS       T00290                                 

Definition
magnesium-chelatase, subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
cch  Chlorobium chlorochromatii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cag_0983
Enzymes [BR:cch01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cag_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1324771..1328595
Genome map
AA seq 1274 aa AA seqDB search
MSSLRKIVAIVGLEQYNAALWQKVKELLAGDAALSQFSDVDLERQNPEAAAAIVGADCIF
VSMINFRDQVEWFKAQLARVQKEQTVFVFESMPEAMALTKVGSYAVSDGKAGMPDVVKKV
AKLLVKGRDEDAMYGYMKLMKIMRTMLPLVPDKAKDFKHWLMVYSYWMQPTAENIANMFR
LILREYCGEQVSVAAVVDVPNMGLYHPDAPAFFTDVRNFKSWQKRRGINPDKQQKVGLLF
FRKHLLQEKTYIDNTIRVLEKDGLCLYPAFVMGIEGHVLVRDWLVKEKIDLLVNMMGFGL
VGGPAGSTKPGIAAEARHEILTKMDVPYMIAQPLLTQGFESWQELGVSPMQVTFTYAIPE
MDGAISPILLGALQDGRIETVPERLERLALLAKQWLRLRASANREKKVAFIVYDYPPGLG
KKATAALLDVPQTLFAILQRLKKEGYNVGTLPNSAEALFEALDRATDPQFVQHDSLVINH
EDFKQVTSYRERERIDERWQQFPGDIVPLGEQELFVGGLRFGNIFIGVQPRIGVQGDPMR
LLFDKANTPHHQYMAFYRWISRTFQAHAMVHVGMHGSAEWMPGLQTGLTGDCWPDALLGE
VPHFYLYPINNPSESTIAKRRGLATMISHVVPPLSRAGLYKELPALRELLLEVRESSLSN
NSTISTLNDLAGLEEAIMQKAELLNLTDDCPRLHNEPLSDYASRLYSYLSELENRLISNS
LHLFGEAAPLESQLVTVTETLKNREENGLCLPSLVLELRGATEAGVNYNEISSLARKGDE
TAIRLREQAEEACRQLIEQVLFERKPLAATFAALCGGIAPSAEVQAFLEQLMREGAQLLA
ALRDNRGEMEALLHALDGGYLPSGPGGDLVRDGVNVLPSGRNIHSIDPWRIPSTTAFRRG
SHIAEAILAKHLEEHDGIYPETIAQVLWGLDTIKTKGEAVAVVICLLGAEPAYDAFGKIS
HYRLIPLEELQRPRIDVLMQLSPVFRDAFGLLMDQLDRLIKDAAKADEPAEMNFVKKHVD
EALAVGMSFESATARQFTQAPGAYGTYVDDMIEDSAWQSENDLDDIFIRRNSNAYGGARK
GENESAIFQKMLASVDRVVHQVDSTEFGISDIDHYFSSSGSLQLAARRRNTRATDVKLNY
VESYTSDIKVDDAAKALRIEYRSKLLNPKWFEGMLKHGHSGAGEISNRVTYMLGWDAVTG
SVDDWVYKKTAETYALDSAMKERLAALNPQAMKNIVGRMLEAHGRGIWNADQEMIDQLQE
IYADLEDRLERVDG
NT seq 3825 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcacttcgtaaaattgttgcaattgttggtcttgagcagtataacgccgctctt
tggcaaaaggttaaggaattgcttgccggcgatgcggcgcttagtcagtttagcgatgtt
gatttagagcgtcaaaatcctgaagcggcggcggctattgttggggctgattgcattttt
gtgagcatgatcaactttcgcgatcaggtagagtggtttaaggcgcagcttgctcgtgtg
caaaaagagcagacggtttttgtgtttgaatccatgcctgaggctatggcgcttaccaaa
gttgggagttatgcggttagcgatggcaaggctggtatgcctgatgttgttaaaaaagtg
gcgaaacttttggtgaaggggcgcgatgaggatgctatgtacggctacatgaagctgatg
aaaattatgcgcaccatgttgccccttgtgcccgataaagcgaaggattttaagcattgg
ttgatggtttattcctattggatgcagccaacggctgagaatattgcgaacatgtttcgt
cttattttgcgagagtattgtggcgaacaagtaagcgttgcggcggttgttgatgtgccc
aatatgggactgtatcatcctgatgcgcctgcattttttaccgatgtacgcaactttaaa
agctggcagaaaaggcgtggcattaatcccgataagcaacaaaaggtgggattactcttt
ttccgtaaacatttactacaagagaaaacctacatagataacacgattcgcgttttagaa
aaggatggattatgcctttatcctgcttttgtaatgggaattgaagggcatgttttagtg
cgcgattggttggtaaaggagaagattgatttattggtgaacatgatgggctttgggctt
gttggtggtcctgcaggctctacaaagcccggcattgcggcagaggcgcgccatgaaatt
cttacaaaaatggatgtgccttacatgattgcgcaaccgttgttaacgcaagggtttgag
tcgtggcaggagttgggcgtttcgcccatgcaggtaacgtttacctatgccattcctgaa
atggatggagcaatttcacccatacttcttggggcgttgcaggatgggcgcattgaaacc
gtacctgagcgtttggagcgattagcgttgcttgcaaagcagtggcttcgtttgcgagcc
agcgcaaatcgtgaaaaaaaggtggcttttattgtttacgattatccgcccggacttggt
aaaaaagctacggcggcgttgcttgatgtgccgcaaacgctctttgctattttgcaacgg
ttgaaaaaagagggctacaatgttggcacgctgcccaattcagcggaggcgctctttgag
gcgcttgatcgtgccaccgatccgcaatttgtgcagcacgactctctcgtcataaatcat
gaagattttaagcaggttacttcatatcgagagcgcgaacgtattgatgagcggtggcaa
caattcccgggcgatattgtgccgcttggtgagcaggagctttttgtcggcggcttgcgc
ttcggcaacatttttataggcgtgcagccgcgcattggcgtgcagggcgatcctatgcgt
ttgctgttcgacaaggcaaatacgccgcatcatcaatacatggcattttaccgctggatt
agccgcacctttcaagcgcacgccatggtgcatgtgggaatgcacggctcggcggagtgg
atgccggggcttcaaacagggcttacgggcgattgctggcctgatgctctacttggtgaa
gtgccccacttttatctctaccccattaacaaccccagtgaatccactattgccaagcgg
cgcggcttagccaccatgatttcgcatgtggtgccgccgctttcgcgagctggattgtat
aaagagctacccgcattgcgcgaattgttgctggaggtgcgcgaaagctccttgagcaat
aattccaccatttccacccttaacgaccttgcagggcttgaagaggcaattatgcaaaaa
gcagaactgttgaacttaaccgacgattgccctcgtttgcataatgagccgttaagcgac
tacgccagccgattgtacagctacctgagtgagcttgaaaatcgcttaatatccaattcg
ctccatctgtttggcgaagctgcaccgcttgagtcgcagcttgtaacggttacagaaacg
cttaaaaatcgtgaagaaaacgggctgtgcctcccctctcttgtgctggaattgagagga
gcaacggaagctggggtcaattacaatgaaataagtagccttgcccgcaaaggggatgaa
actgctattcgcttgcgggaacaagccgaagaggcgtgtcggcagcttatagaacaggtg
ctttttgagcgcaagccgcttgcagcaacgtttgcagcactttgcggtggcatagctcca
tcggcggaggtgcaagcctttcttgagcaacttatgcgcgaaggcgcacaactcttagcg
gctcttcgagataatcggggggaaatggaggcgctgctccatgcgcttgatgggggctac
cttccatcgggaccaggcggcgaccttgtgcgcgatggcgtaaatgtgctgccatcgggg
cgcaacattcactccattgatccatggcgcattccctcaaccaccgcatttcggcgcggt
agccacattgccgaagccattcttgccaaacatcttgaagagcacgatggcatctatccc
gaaaccattgctcaagtgctatgggggcttgataccattaaaaccaaaggcgaagcggtt
gccgttgtgatttgcctgcttggcgccgagccagcttacgatgcgtttggcaaaattagc
cactaccgccttatcccgcttgaggagctgcaacgcccccgcattgacgtgctcatgcag
ctcagccccgtttttcgcgacgcatttggcttgctgatggatcagcttgatcgcctcatt
aaagatgccgctaaagcggatgaaccagcagaaatgaactttgtgaaaaagcatgttgat
gaagcacttgcggtaggcatgagctttgaaagcgccactgcccgccaatttacccaagca
ccgggcgcttacggcacctacgttgacgacatgattgaagattctgcatggcaatccgaa
aacgacctcgacgacatttttattcgccgcaacagcaacgcatacggcggcgcacgcaag
ggcgaaaatgaatcggcaattttccaaaaaatgcttgcctccgttgaccgtgtagtgcat
caagttgactccaccgaatttggcatctccgacattgaccactacttctcatcctcaggc
tcacttcagcttgccgcccgccgccgcaacacccgcgcaaccgacgtcaagctaaattac
gtagaatcatacacatccgacattaaagttgacgacgcagcaaaagcgctccgcattgag
taccgctcaaaactgctcaatcccaaatggtttgaaggaatgctaaaacatgggcatagc
ggcgcaggcgaaattagcaaccgtgtaacctacatgcttggctgggacgccgttacgggc
agcgttgacgattgggtctataaaaaaaccgccgaaacctacgcacttgactcagccatg
aaagagcgactcgcagcacttaacccccaagccatgaaaaacattgttgggagaatgctt
gaagcgcacggtcgtggtatctggaacgccgatcaggagatgattgaccaattgcaagag
atttacgccgatcttgaggataggttggaacgggtagatggatga

DBGET integrated database retrieval system