KEGG   Chlorobium chlorochromatii: Cag_1282Help
Entry
Cag_1282          CDS       T00290                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cch  Chlorobium chlorochromatii
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cch00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cch00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1746629..1747900
Genome map
AA seq 423 aa AA seqDB search
MNKLVIQGGRPLSGTLTASGSKNTSLPIIAATLLHGGGTFTLHRIPNLQDIDTFRQLLHH
LGAESSLENNTLTISTANVNSILAPYELVKKMRASIYVLGPLLARFGHARVSLPGGCAFG
PRPIDLHLMVMEKLGATITIETGFIDAVAKEGKLRGAHIHFPISSVGATGNALMAAVLAE
GTTTLTNAAAEPEIETLCNFLIAMGATIRGVGTTELEIEGTSSLHAVTFNNVFDRIEAGT
LLAAAAITGGDITLLEANPRHMKSVLKKFAEAGCTIETTPDSITLKSPETLLPVDVTAKP
YPSFPTDMQAQWIALMTQANGTSRITDKVYHERFNHIPELNRLGAGIEIHKNQAIVHGIR
KLSGGPVMSTDLRASACLVLAGLVAEGTTEVLRVYHLDRGYENIEMKLRTLGASIERQKY
QEF
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcttgtcattcaaggcggacgccctcttagcggtacgctcaccgcttcaggc
tctaaaaacacctcgctccccattattgcggcaaccttgctccatggtggaggcaccttt
accctccaccgcattcccaatttgcaagatattgatacgttccgtcagcttttacaccat
cttggtgccgaaagctcgcttgaaaacaatacgcttaccatttcaaccgccaacgttaac
agtattttagcgccttacgagttagtaaaaaaaatgcgcgcctccatttatgtgctagga
ccactacttgcacgctttgggcatgctcgcgtttcactgcccggtggttgtgcctttgga
cctcgccccattgacctccatttaatggtcatggaaaaacttggcgctaccataacgatt
gaaacaggctttattgatgcagtagctaaagagggtaaacttcgcggtgcacatatccac
tttcccatttcttccgtaggcgctacaggcaatgcactgatggctgccgtattagccgaa
ggcaccacaacgcttaccaacgccgccgccgagcccgaaattgaaacgctctgcaacttt
ctgattgcaatgggagccactattcgcggcgttggcaccaccgagttagaaattgaaggc
acctcatcactgcacgccgttacctttaataatgtttttgatagaattgaagcgggcaca
ctgcttgcagcggcggctattacgggaggagatattacgctacttgaagccaatcctcgc
cacatgaaaagcgtcttaaaaaaattcgctgaagcaggctgcactattgaaacaacaccc
gacagcatcaccctaaaaagccccgaaacgttactgccggttgatgttactgcaaagcca
tatccatccttcccaaccgatatgcaagcgcaatggattgccttaatgacgcaagccaac
ggcaccagccgcattaccgacaaagtgtatcacgaacgttttaaccacattcccgaactc
aatcggttgggggcaggcattgaaattcataaaaatcaagccattgtgcatggcatacgc
aaactctcaggcggaccagtaatgtccaccgatttacgcgcctcagcctgccttgtgctt
gcagggcttgttgctgaaggcacaaccgaagtactgcgggtttatcacctcgatcgaggt
tacgaaaacattgagatgaagcttcgtacacttggcgcctccattgaacgccaaaaatat
caagagttttaa

DBGET integrated database retrieval system