KEGG   Chlorobium chlorochromatii: Cag_1297Help
Entry
Cag_1297          CDS       T00290                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cch  Chlorobium chlorochromatii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cag_1297
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cag_1297
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cag_1297
Enzymes [BR:cch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cag_1297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1761182..1762381)
Genome map
AA seq 399 aa AA seqDB search
MEPSLYSAPDAAGHYGYFGGKFIPETLIKNAADLEAEYLRAKQDPAFQQELTLLLRDYVG
RPTPLYHATRLSQQVQGAQIYLKREDLCHTGAHKINNALGQVLLARRMGKKRVIAETGAG
QHGVATATVCALFNLECVVYMGEEDICRQAPNVARMKLLGAEVRAVSSGSRTLKDATSEA
IRDWMNNPEETFYIIGSVVGMHPYPMIVRDFQSVIGKETRQQIIAQAGRLPDVITACVGG
GSNAIGMFYEFLKDAAMVELVGVEAAGEGLTGRHAASLTLGTPGVLHGALTRLLQNNDGQ
VLEAHSISAGLDYPGVGPEHCYLQELGLVSYTSVTDTEALEALATLAKTEGIICALESAH
AIHYAIKRAKQMAHDGILIVNLSGRGDKDMETIIRELGL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggagccctctctttactctgcacccgatgctgctggacactacggctattttggcggc
aaatttattccagaaacgcttattaaaaatgcggctgatttagaggctgaatatttacga
gccaagcaagaccccgcttttcagcaagagttaacgctgttgctgcgcgactatgttggt
cgtcctacgccgctctaccatgcaacgcgtttaagccaacaagtgcaaggagcgcaaatt
tatttaaagcgcgaagatttgtgccatacaggtgcgcataaaattaataatgcccttggt
caagtgctgcttgctcgacgcatgggcaaaaagcgcgttattgctgaaacaggtgcaggg
cagcatggggttgcaacggcaacggtgtgtgcgctttttaatttagaatgcgtggtttat
atgggcgaagaggatatttgccgtcaagcgccaaatgttgcacgcatgaagctcttgggt
gctgaagtgcgagccgtaagcagtggttcgcgaacgcttaaagatgccaccagcgaagca
attcgcgattggatgaataatcccgaagagaccttttacattattggatcagtggttgga
atgcacccctaccccatgattgtgagagattttcaatcagtaattgggaaggaaactcgg
cagcaaattattgcacaagcgggtcgtctgccggatgttattaccgcttgtgttggtggt
ggcagcaatgccattggtatgttttatgaatttttaaaggatgccgcaatggttgaattg
gtgggggttgaagctgcgggcgaagggcttacagggcgccatgccgcatcactaacgctt
ggaacgcccggcgtattgcatggagccttaacgcgccttctccaaaacaatgacgggcaa
gtgcttgaagcacactccatttcagcggggttagattacccgggtgttgggcctgaacat
tgctatttgcaagagcttggcttggtttcttacacctccgttaccgacaccgaagcgctt
gaagccttagccacgcttgctaaaacggaaggcattatttgtgccttagagtcagctcat
gcaattcattatgccatcaaacgagcaaagcaaatggcgcacgatggaattttaattgtc
aacctgtcgggcaggggcgataaagatatggagaccattattcgcgaattggggttgtaa

DBGET integrated database retrieval system