KEGG   Chlorobium chlorochromatii: Cag_1297Help
Entry
Cag_1297          CDS       T00290                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cch  Chlorobium chlorochromatii
Pathway
cch00260  Glycine, serine and threonine metabolism
cch00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cch01100  Metabolic pathways
cch01110  Biosynthesis of secondary metabolites
cch01130  Biosynthesis of antibiotics
cch01230  Biosynthesis of amino acids
Module
cch_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cag_1297
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cag_1297
Enzymes [BR:cch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cag_1297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP THUMP
Motif
Other DBs
NCBI-ProteinID: ABB28557
JGI: Cag1297
UniProt: Q3AR18
Position
complement(1761182..1762381)
Genome map
AA seq 399 aa AA seqDB search
MEPSLYSAPDAAGHYGYFGGKFIPETLIKNAADLEAEYLRAKQDPAFQQELTLLLRDYVG
RPTPLYHATRLSQQVQGAQIYLKREDLCHTGAHKINNALGQVLLARRMGKKRVIAETGAG
QHGVATATVCALFNLECVVYMGEEDICRQAPNVARMKLLGAEVRAVSSGSRTLKDATSEA
IRDWMNNPEETFYIIGSVVGMHPYPMIVRDFQSVIGKETRQQIIAQAGRLPDVITACVGG
GSNAIGMFYEFLKDAAMVELVGVEAAGEGLTGRHAASLTLGTPGVLHGALTRLLQNNDGQ
VLEAHSISAGLDYPGVGPEHCYLQELGLVSYTSVTDTEALEALATLAKTEGIICALESAH
AIHYAIKRAKQMAHDGILIVNLSGRGDKDMETIIRELGL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggagccctctctttactctgcacccgatgctgctggacactacggctattttggcggc
aaatttattccagaaacgcttattaaaaatgcggctgatttagaggctgaatatttacga
gccaagcaagaccccgcttttcagcaagagttaacgctgttgctgcgcgactatgttggt
cgtcctacgccgctctaccatgcaacgcgtttaagccaacaagtgcaaggagcgcaaatt
tatttaaagcgcgaagatttgtgccatacaggtgcgcataaaattaataatgcccttggt
caagtgctgcttgctcgacgcatgggcaaaaagcgcgttattgctgaaacaggtgcaggg
cagcatggggttgcaacggcaacggtgtgtgcgctttttaatttagaatgcgtggtttat
atgggcgaagaggatatttgccgtcaagcgccaaatgttgcacgcatgaagctcttgggt
gctgaagtgcgagccgtaagcagtggttcgcgaacgcttaaagatgccaccagcgaagca
attcgcgattggatgaataatcccgaagagaccttttacattattggatcagtggttgga
atgcacccctaccccatgattgtgagagattttcaatcagtaattgggaaggaaactcgg
cagcaaattattgcacaagcgggtcgtctgccggatgttattaccgcttgtgttggtggt
ggcagcaatgccattggtatgttttatgaatttttaaaggatgccgcaatggttgaattg
gtgggggttgaagctgcgggcgaagggcttacagggcgccatgccgcatcactaacgctt
ggaacgcccggcgtattgcatggagccttaacgcgccttctccaaaacaatgacgggcaa
gtgcttgaagcacactccatttcagcggggttagattacccgggtgttgggcctgaacat
tgctatttgcaagagcttggcttggtttcttacacctccgttaccgacaccgaagcgctt
gaagccttagccacgcttgctaaaacggaaggcattatttgtgccttagagtcagctcat
gcaattcattatgccatcaaacgagcaaagcaaatggcgcacgatggaattttaattgtc
aacctgtcgggcaggggcgataaagatatggagaccattattcgcgaattggggttgtaa

DBGET integrated database retrieval system