KEGG   Chlorobium chlorochromatii: Cag_1315Help
Entry
Cag_1315          CDS       T00290                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cch  Chlorobium chlorochromatii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cag_1315
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cag_1315
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cag_1315
Enzymes [BR:cch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cag_1315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1781123..1781926
Genome map
AA seq 267 aa AA seqDB search
MAQNRITRLMQQQKKLLIAYYMPEFPVAGATLPVLEALQEHGADIIELGIPYSDPIGDGP
VIQNAAHTAIRNGVTLRKVLELVRKARNGEGCKKITVPIVLMGYSNPLFAYGGDCFLADA
IDSGVDGVLIPDFPPEEAIDYLDRAKNVGLSVIFLIAPVTSPERIEFIDSLSTDFSYCLA
VNATTGTAKLSGHAGDAAVEEYLHRVRQHTKKKFVVGFGIRDKERVESMWKLADGAVVGT
ALLEQLAASTTPQECAERAGTFWQSLR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaaccgaattacccgattgatgcaacagcaaaaaaagctgttgattgcttac
tacatgcccgaatttcctgtagcgggcgcaacgttgcctgtgttggaagcgctgcaagag
catggagctgatattattgagttgggaattccttattccgatcccattggcgatggtccc
gttattcaaaatgctgcccacacggcgattcgtaacggcgttactttgcgcaaggtgctt
gagttggtgcgtaaagcccgaaatggcgaagggtgcaaaaaaattaccgtgccaattgtg
ttgatgggctacagcaatccgctctttgcttacggtggcgattgctttttagccgacgca
attgattcgggcgttgatggcgtgcttatccccgactttccgcccgaagaggcaattgat
tatttagatagggcaaaaaatgttgggctatccgtcatctttttaattgcccctgttacc
tcgcctgagcgcattgaatttattgattccctctccaccgacttctcttactgccttgcc
gttaatgccacaacgggcacggcaaagctttcgggacatgcgggcgatgccgctgttgaa
gagtacctccaccgcgttcggcagcacaccaagaaaaagtttgtggtgggctttggcatt
cgcgataaagagcgtgttgaatccatgtggaagcttgccgatggcgctgtggttggcacg
gcattgttggagcaacttgccgcctccaccacgccgcaggagtgcgctgaacgagcaggc
actttttggcaatcgttgcggtaa

DBGET integrated database retrieval system