KEGG   Chlorobium chlorochromatii: Cag_1456Help
Entry
Cag_1456          CDS       T00290                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cch  Chlorobium chlorochromatii
Pathway
cch00230  Purine metabolism
cch01100  Metabolic pathways
Module
cch_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Cag_1456
Enzymes [BR:cch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Cag_1456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 SKI AAA_16 AAA_25 AAA NTPase_1 CbiA AAA_22
Motif
Other DBs
NCBI-ProteinID: ABB28712
JGI: Cag1456
UniProt: Q3AQL3
Position
complement(1922567..1923139)
Genome map
AA seq 190 aa AA seqDB search
MAVEPSGKLIVFSAPSGAGKTTIATMVLQRIANLSFSVSATTRKQREGEQDGVNYYFLDK
ATFEKKIEQGGFIEHEFFFGNYYGTLLDATESVLASGKNLLLDVDVKGALNVRKLFGERS
LLIFIQPPSMEVLIERLQGRGSEDDAALQERLERARFEMSFADQFDTIIVNNNLTAAVDD
VEAAIVNFIG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcagttgaaccttcaggcaaacttattgtgttttcagctccatcgggggcaggcaaa
actaccattgcaactatggtattgcaacgcattgcaaatcttagcttttcggtgtcggca
acaacacgcaagcaacgagaaggggagcaagatggggtgaattattattttcttgataaa
gccacctttgaaaaaaaaattgagcaaggcggttttattgaacatgaatttttctttggc
aactactacggcaccttgcttgatgccaccgaatcggtgttggcatcgggcaaaaatttg
ctgcttgatgtagatgttaaaggagcgttaaacgtccgtaaattgtttggtgaacgctca
ctccttatttttatacagccaccaagtatggaagtgcttattgagcgcttgcaagggcgt
ggcagcgaagatgatgctgcattgcaagagcgccttgaacgtgctcgctttgaaatgagc
tttgccgatcagttcgatacaattatagtgaacaacaatttaacagccgctgttgatgac
gttgaagcggcaattgtcaactttataggatag

DBGET integrated database retrieval system