KEGG   Chlorobium chlorochromatii: Cag_1620Help
Entry
Cag_1620          CDS       T00290                                 

Definition
magnesium chelatase ATPase subunit D (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cch  Chlorobium chlorochromatii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cag_1620
Enzymes [BR:cch01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cag_1620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2117852..2119717)
Genome map
AA seq 621 aa AA seqDB search
MIAFTDIVGMDLAKQALMLLAVDPELGGVVIPSAVGSGKSTLARAFADILLPGTPFVELP
LNVTEDRLIGGVDLEATLASGQRVVQHGVLSKAHGGVLYVDSLSLLDSSAVSHIMDAMSR
GEVLVEREGLSEVHPAKFMLVGTYDPTDGEVRMGLLDRIGIIAPFTAQNDYRARKKIVSV
VLGERDAEDVQDELNMLVGFIKAAREQLQHVAISDDKIRALIQTALSLGVEGNRADIFAI
RAALASAALAQRNDVDEEDMKQAIKLVLVPRATRMPDREADAADAPPQEEMPPPPEETDM
EDEEAPADAPDSDGDAEEEKEETPDMLEELMMEAVETELPDNILNISLASKKKTTTGSRG
EALNFKRGRFVRSQPGEVRSGKVALIPTLISAAPWQEARRRDSKLAGKSKSALIITKDDV
KIKRFRDKSGTLFIFMVDASGSMALNRMRQAKGAVASLLQNAYVHRDQVALISFRGKQAQ
VLLPPSQSVDRAKRELDVLPTGGGTPLASALFVGWETAKQARVKGISQIMFVLITDGRGN
IGLQSSFDPTAEKPSKEELEKEVEALSASISADGIAAIVIDTQMNYLSRGEAPKLAQRLN
GRYFYLPNAKADQIVEAALSF
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgatagcctttaccgatattgtaggtatggatctggcaaagcaagcgttaatgctgctt
gctgttgatcctgaacttggcggagtggtgattccttcggctgtagggtcggggaaatca
acattagcgcgtgcttttgcggatattcttctgcctggcacgccttttgtggaacttccg
cttaatgttactgaagatcgcctgattggcggtgttgatcttgaagctacgcttgcaagc
gggcagcgcgtggtgcagcatggtgtgctttccaaagcgcatggtggtgtgctttacgtt
gattcgctcagtttgcttgatagttctgccgtttctcacattatggacgcaatgtcgcgt
ggcgaggtgcttgttgagcgtgaagggttaagcgaagtgcatcctgcaaagttcatgtta
gttggcacatacgatcctacggatggcgaagtgcgcatgggtttgcttgaccgcattggt
attattgcgccctttaccgcgcaaaacgattaccgtgctcgcaaaaaaattgtgagcgtt
gtgcttggtgagcgcgatgctgaggatgtgcaggatgagctcaatatgcttgtaggcttt
attaaagccgcacgcgagcaattgcaacacgttgccatttcggacgataaaattcgcgcc
cttattcaaaccgcgttaagtcttggggttgaagggaaccgtgccgatatttttgccatt
cgtgccgctcttgcatctgctgcgcttgcacagcgtaatgatgtggatgaagaggatatg
aagcaggcaattaagttagtattggtgcctcgtgcaactcgaatgccagatcgtgaagcc
gatgcggctgatgcgccaccgcaagaggagatgcctccaccgcccgaagagacggatatg
gaagatgaggaagctccagccgatgcgcccgatagcgatggtgatgctgaagaagagaag
gaagagacgccagacatgctcgaagagttgatgatggaagcggtagaaaccgaattaccc
gacaacattctcaacatttcacttgcctcaaaaaagaaaaccacaacgggtagccgtggt
gaagcgctaaactttaagcgtggacgctttgtgcgttcacaaccgggtgaagtgcgcagt
ggcaaggtggcacttattccaacgcttatttctgccgcaccgtggcaggaagcacgtcgc
cgcgatagcaagcttgcaggcaagtcgaagagcgcccttattatcaccaaagatgatgtt
aaaattaagcgcttccgcgacaaatcgggtacgctctttatttttatggtggatgcctca
ggctctatggcgctcaaccgtatgcgtcaagccaaaggtgccgttgccagcttactgcaa
aatgcttacgtgcatcgcgatcaagttgctttaatctccttccgaggcaaacaagcccaa
gtgctgctaccgccatcgcagagcgttgaccgtgcaaaacgagagcttgatgtgctgcca
acgggcggaggaacaccgcttgcctcagcgctctttgttgggtgggaaactgctaaacaa
gcacgggtaaaaggcatttcgcaaattatgtttgtgcttattaccgatggacgtggcaat
attggtttgcaatcttcttttgatcctacggcagaaaagccaagcaaagaggagcttgaa
aaagaggtggaagcactttcggcatccatttcagccgatggcattgccgcaattgtaatt
gatacgcaaatgaactatctctcacgaggcgaagcgccaaaacttgcgcaacggcttaat
gggcgatatttttacttgccgaatgcaaaggctgatcaaattgttgaagctgcattgagt
ttttaa

DBGET integrated database retrieval system