KEGG   Chlorobium chlorochromatii: Cag_1621Help
Entry
Cag_1621          CDS       T00290                                 

Definition
magnesium chelatase ATPase subunit I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cch  Chlorobium chlorochromatii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cch00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2119717..2120865)
Genome map
AA seq 382 aa AA seqDB search
MTQTETSAKKAAKKSVAANATADSEAAVKPAGKKKSGLAFPFTAIVGQEEMKLSLILNII
DPRIGGVLVMGHRGTGKSTTVRALAEVLPLIDRVEGDTYNRTVEQFVEAEGSKKGGKAID
PASVKTEKIPVPVVDLPLGATEDRVCGTIDIEQALTSGVKAFEPGLLAQANRGFLYIDEV
NLLDDHLVDVLLDVAASGQNVVEREGISIRHPARFVLVGSGNPEEGELRPQLLDRFGLHA
RIVTILDVAKRVDIVKRRREFDEDPDAFMVKYQEEQMALSAKIQTAKNLLPQVTMSDDVL
TDIARLCMNLGIDGHRGELTITRTAHAHAAFMGDNEVTMKHVRDIAGLCLRHRLRKDPLE
TLDAGEKIEREIAKVLGEAEAV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgactcagactgaaacatcagcaaaaaaagctgccaaaaaaagtgttgcagcaaacgct
acggctgactcagaagccgcagtaaaaccagcgggaaagaaaaaatctggtctggcattt
ccttttacagctattgttggtcaggaggagatgaagctaagtttgattctcaatattatt
gatcctcgcattggcggtgtgctggtaatggggcatcgtggtacgggtaaaagtaccact
gtgcgtgctttagccgaagtgttgccgcttattgaccgtgttgaaggcgatacctacaat
cgcaccgttgagcaatttgtagaagctgaaggcagcaaaaaaggtggtaaagctattgat
ccagcatcggtaaaaaccgaaaaaattccagtgcctgtggttgatttaccgcttggtgct
actgaagaccgtgtgtgcggtaccattgatattgagcaggcgcttaccagtggtgttaaa
gcttttgagcctggtttgcttgctcaagcgaaccgtggctttctttatattgacgaggtg
aatttgcttgatgaccacttggttgatgtgctgcttgacgtggctgccagcggtcaaaac
gtggttgaacgtgaaggtattagtattcgccatccggcccgttttgtgcttgtgggttca
ggtaaccctgaagagggtgaacttcgtcctcagcttcttgaccgttttggtttgcatgct
cgtattgtaaccattcttgatgttgcaaagcgcgttgatattgtaaagcgtcgtcgtgaa
tttgatgaagatcctgatgcttttatggtgaaatatcaagaagagcaaatggcgctttct
gcaaaaattcaaaccgctaaaaatcttctcccccaagtaaccatgagcgatgatgttctt
accgacattgctcgcctttgcatgaacctcggtattgatggacaccgtggtgaacttacc
attactcgcacggctcacgcccatgcagcttttatgggcgataatgaagttaccatgaag
catgtgcgcgatattgcaggactttgccttcgccaccgtttgcgcaaggatcctcttgaa
acccttgatgctggtgaaaaaattgaacgtgaaattgcaaaagtcctcggagaagcagaa
gccgtataa

DBGET integrated database retrieval system