KEGG   Chlorobium chlorochromatii: Cag_1780Help
Entry
Cag_1780          CDS       T00290                                 

Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cch  Chlorobium chlorochromatii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cag_1780
   01230 Biosynthesis of amino acids
    Cag_1780
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cag_1780
   00030 Pentose phosphate pathway
    Cag_1780
   00051 Fructose and mannose metabolism
    Cag_1780
   00052 Galactose metabolism
    Cag_1780
  Energy metabolism
   00680 Methane metabolism
    Cag_1780
Enzymes [BR:cch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cag_1780
Protein phosphatases and associated proteins [BR:cch01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cag_1780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2297911..2299116)
Genome map
AA seq 401 aa AA seqDB search
MKKIGILTSGGDCGGLNAVLKGAALMAQSKGLELYIIPNGYAGLYNLVDQERIVRLDRIR
LDQFDASFAGSEAGHSRVKIKAISNPEKYNRIKAGMKKFELDALIISGGDDSGSVMVDLN
HQGIQCIHAPKTMDLDLQTYSVGGDSTINRIAQFVHDLKTTGKTHNRVLVTEVFGRYAGH
TAFRSGIAAEADCILIPEIPADWDVVYEHLKERFTRRIKDSDVHSGTYTIVVAEGLKNAD
GTDIVDESAGVDAFGHKKLAGAGKFTCQQIQKRMKADPAMPLFMKETGMFVEGVYEIPEV
REIHPGHLVRSGNSSAYDINFGFEAGAAAVLLLLDGKTGVTVSRVKGRKVEYIESSKAIV
QRHVDLEQVALHESLGICFGRAAHAYEPILREVEGVYDRIY
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaattggcatccttaccagcggtggagattgcggcggtttaaatgctgtgcta
aaaggcgcagccttaatggcgcagtccaaagggcttgaactttacattattcctaacggc
tatgcaggcttgtacaatcttgtggatcaagagcgtattgtaaggcttgatcgcattcgt
cttgatcagttcgatgcaagttttgcaggttctgaggctgggcattcgcgcgttaaaatt
aaagctattagcaatcctgaaaagtataaccgcattaaagcgggcatgaagaagtttgag
cttgatgcccttattattagtggtggcgacgattcgggtagcgttatggttgacttgaat
catcaaggcattcagtgcattcatgcgccaaaaaccatggatctcgacttacaaacctac
tcagttggcggcgactctaccattaaccgcattgcacaatttgtgcacgaccttaaaact
acgggtaaaacgcacaatcgtgtgcttgtaaccgaagtgtttgggcgttatgcaggtcat
acggcttttcgtagtggtattgcggctgaagccgattgtattttaattcctgaaattcct
gctgattgggacgtggtgtatgagcatcttaaagagcgctttactcgccgcattaaagat
agcgacgtgcatagtggcacttacaccattgtggttgctgaagggttgaaaaatgctgat
ggcactgatattgtggatgaatcggcaggtgttgatgcttttgggcataaaaagcttgct
ggagctggaaaatttacctgtcagcaaatccaaaagcgtatgaaagccgatcctgctatg
cctctttttatgaaagaaaccggcatgtttgttgaaggcgtttatgaaattcctgaggtg
cgcgaaattcaccctggtcatttagtgcgttctggtaactcatcagcttacgacattaat
tttggttttgaagctggagcggctgccgtactgttgttgcttgatggcaaaacaggtgta
accgtttcaagggtaaaggggcgcaaagttgaatacattgagtcaagcaaagccattgtg
cagcgccatgttgaccttgagcaagttgccttgcatgagtcgcttggcatttgctttggg
cgagcagctcatgcgtatgaaccaattttgcgtgaggttgaaggggtgtatgatcgtatc
tattaa

DBGET integrated database retrieval system