KEGG   Chlorobium chlorochromatii: Cag_1939Help
Entry
Cag_1939          CDS       T00290                                 

Definition
lysophospholipase L2 (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cch  Chlorobium chlorochromatii
Brite
Enzymes [BR:cch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Cag_1939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2471042..2471794)
Genome map
AA seq 250 aa AA seqDB search
MPEPKPHTLAVLVLHGFSGTLESVKALREPLQALGLPVAMPLLAGHGEHSPEALRGVTWE
TWLADAEEALLQLSNQALQVIVIGHSMGALLAVQLAYRYPTLVDSLVLAAPALRIASIFA
PGRLFHSIAPIVSRLVKNWRLQSEEDRRNAVYGDLHYEWVPTKTVLSFFELVKKTERLLP
HITHPALILHCRCDNTVLPESAEIAHSSLGSMPAAKSLVWFDKVGHQLFCATERDCVVLE
IVGFVKSRFR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccaaagccacatacccttgctgtgcttgtattgcatggtttttcgggaacg
cttgaaagcgttaaggcattgcgcgagccattgcaagcgcttggcttgcctgtggcaatg
ccgcttttggctgggcatggggagcattcgcctgaggctttgcgtggtgttacatgggaa
acgtggcttgccgatgctgaagaggcactgcttcagttatccaatcaagctctgcaagtg
attgttattgggcatagcatgggtgctctcttagcagtgcagttagcttatcgttatcct
acgttggttgattcattagtgctcgcagctcctgcattacgcatcgcctccatttttgcg
cccgggcgcttattccacagtattgcgccaatagtaagccgattggtgaaaaattggcgt
ttgcaaagtgaagaggataggcgtaatgcggtgtatggtgatttgcattatgagtgggtg
cccacaaaaaccgtgctctcattttttgagttggtgaaaaaaacagagcgacttttgccg
cacattacccatcccgcattgattttgcactgccgttgcgataatacggtgttgcctgaa
agtgcagagattgcgcacagtagtttaggttctatgcctgccgcaaaatcgttagtgtgg
tttgataaggtagggcatcagcttttttgtgctaccgagcgcgattgtgttgtgctggaa
attgtagggtttgtaaaaagtcgttttaggtga

DBGET integrated database retrieval system