KEGG   Chlorobium chlorochromatii: Cag_1980Help
Entry
Cag_1980          CDS       T00290                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K03386  
peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC:1.11.1.15]
Organism
cch  Chlorobium chlorochromatii
Brite
Enzymes [BR:cch01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     Cag_1980
Exosome [BR:cch04147]
 Exosomal proteins
  Proteins found in most exosomes
   Cag_1980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2510734..2511399)
Genome map
AA seq 221 aa AA seqDB search
MHDDELYYDISMPLLGDDFPEMEVQTTHGVMNIPGDLKGSWFVLFSHPADFTPVCTTEFV
AFQERIAEFDKLGCKLIGMSVDQVFSHIKWIEWIKDTLNIEITFPIVAANDRIANKLGML
HPGKGSNTVRAVFVCDPNGKVRLVLYYPQEIGRNMAEILRAVTALQISDNNKVAIPADWP
NNSLIKDEVIIPPAKDVAEAQKRKNMGGCYDWWFCHKPLDK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacgatgaactgtactacgatatttccatgccattgcttggcgacgactttcct
gaaatggaagtgcaaaccactcacggagttatgaacattccgggcgatttaaaaggctca
tggtttgtgttgtttagccatcctgccgactttacccctgtgtgtaccaccgaatttgtt
gcattccaagagcgtattgctgagttcgacaaacttggctgtaagcttattggtatgagt
gttgaccaagttttttcacacatcaaatggattgagtggattaaggataccttaaacatt
gaaattaccttcccaattgttgcggctaacgatcgcattgccaataagcttggcatgttg
cacccaggcaaagggagcaacacggtgcgtgccgtttttgtgtgcgaccccaacggcaag
gtgcgtttagtgctctactatccgcaagagatagggcgcaacatggctgaaattttacgc
gctgttacggctttgcaaatttctgacaacaataaagtggcaattcctgccgactggcct
aacaactctcttattaaggatgaggtaattattcctcccgcaaaagatgttgctgaagcg
caaaagcgcaaaaacatgggaggttgctacgattggtggttctgccataaaccgcttgat
aagtaa

DBGET integrated database retrieval system