KEGG   Coprinopsis cinerea: CC1G_00344Help
Entry
CC1G_00344        CDS       T01275                                 

Definition
disulfide isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cci  Coprinopsis cinerea
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cci00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CC1G_00344
Enzymes [BR:cci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CC1G_00344
Exosome [BR:cci04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CC1G_00344
  Exosomal proteins of colorectal cancer cells
   CC1G_00344
  Exosomal proteins of bladder cancer cells
   CC1G_00344
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 503 aa AA seqDB search
MRLVVPASFLTLASLVFAEAASDVISLTAANFESSVNSEPLLLVEFFAPWCGHCKALAPH
YEEAATTLKEKNIKLAKVDCVEEADLCQSKGIQGYPTLKVYRNGKDSEYNGPRKADGIVS
YMVKQSLPAVSDVTADKHEEFTKADKIVAIAYLPSSTAAPAPEFSAAAEAHRDDYLFGIV
TDQDVAAAAGVTPPAIVVYRSFDEPRTEYPYPVSGTNKKELEDWIAELAIPIIDEVNGET
YGLYAKSGKPLAYLFIDPSKPEKDAQIELIKPVAKKYKSKVNFVWIDAVKYGDHGKALNL
PDTNWPSFVVQDLDKQLKYPFDQTKAITTEAIGEFLESYVTGKLEPSLKSQPIPETQDEP
VYTLVGKNFEEVVFDDSKDVFVEFYATWCGHCKRLKPTWDQLGEKYAAIKDKIVIAKFEV
PENDLPPTVPFRISGFPTLKFKAAGSKEFVDYEGDRSLESLVSFVEANAKNSLEIPKAEP
KADEPEAQKPVEKEAEGIHREEL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctcgtagtaccggcctcgttcttgactctcgcctctctggtcttcgctgaggct
gcctccgatgttatcagcttgacggccgccaacttcgagtcctctgttaactcagagccc
ctgctcttggttgagttcttcgctccatggtgtggtcactgcaaggccctcgctccccac
tacgaggaggccgccaccaccctcaaggagaagaacatcaagctcgccaaggtcgactgt
gttgaggaagccgacctttgccagtccaagggcatccagggctaccccacccttaaggtc
tatcgcaacggcaaggacagcgagtacaatggtcctcgcaaggccgacggtatcgtcagc
tacatggtcaagcaatctttgcccgctgtctctgacgtgaccgctgacaagcacgaggaa
ttcaccaaggctgacaagattgtcgccattgcctaccttccttcctctaccgctgccccc
gcccctgagttcagcgccgccgccgaagctcatcgtgacgactaccttttcggtattgtg
accgaccaggacgtcgctgctgctgccggtgtcacccctcccgccatcgtcgtctaccgc
tccttcgatgagcctcgcaccgaatacccctaccccgtctccggcaccaacaagaaggag
cttgaggactggattgctgaactcgccatccccatcatcgacgaagtcaacggtgagacc
tacggtctctacgccaagagcggcaaacccctcgcctacctcttcattgacccctccaag
cctgagaaggacgcccaaattgaactcatcaagcccgtcgccaagaagtacaagtccaag
gtcaactttgtctggatcgacgctgtcaagtacggtgaccacggcaaggccctcaacctc
cccgacaccaactggccctcgttcgtcgttcaggatttggacaagcaactcaaatatccc
ttcgaccaaaccaaggctatcaccactgaggccattggcgagttcctcgagagctacgtc
accggcaagctcgaaccctcgctcaagagccagcctatccccgaaacccaggatgagcct
gtctacactctcgtcggaaagaactttgaggaggttgtcttcgacgacagcaaggatgtc
ttcgttgaattctatgctacctggtgcggtcactgcaagcgtctcaagcccacttgggat
caactcggtgagaagtacgccgccatcaaggacaagatcgtcattgccaagtttgaagtt
cctgagaacgaccttcctcccaccgtccccttccgcatcagcggcttccccactcttaag
ttcaaggccgctggctccaaggaattcgttgactatgagggcgaccgctcccttgagagc
ctcgtttccttcgtcgaggccaacgccaagaacagccttgagatccccaaggctgaaccc
aaggctgacgagcccgaggctcagaagcctgttgaaaaggaggctgagggcatccaccgg
gaagagctctga

DBGET integrated database retrieval system