KEGG   Coprinopsis cinerea: CC1G_00386Help
Entry
CC1G_00386        CDS       T01275                                 

Definition
longevity-assurance protein 1
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
cci  Coprinopsis cinerea
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cci00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 436 aa AA seqDB search
MTSRNVKGRNGAAPPKIVTAKLDVSPLSNGFAQKRPESPFNWSLFATDATGLSNPRALFV
SRRGVETNQTRSMAGMGHRTRYTQSLSIRAQKSDTRPVIALKLLLIPVVLYFNWEFVARY
VSPPLSNPFGPFFLLSGYVEGSKPDDPRYAKSWLDFLFLGFYIVFWSMVRQTIAVNIARP
IARYFGLRKEAKIDRFGEQLYAMIYFAICGAWGYRVMKQLPTYWYQTEHFWIALLDYPHW
DMKGELKRYYLMQFSYWCQQFIVLLLGLEKPRKDYWELVAHHFVTMWLVGWSYGLNFTII
GSAVYMSMDIPDSFLAASKLLNYMQWNRAKIVSFVTFIAVWTYFRHYLNLKILWSCLFET
QLVPESSKIWSFENGTYMVNWMPFMVFGSIFALQILNLFWYYLMWRILIRAIITREADDD
RSDDEGDDDDEPDKED
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaaggaacgtcaaagggcgcaatggcgctgctccccccaaaatagtcaccgcc
aaattagacgtcagtccgctttctaacgggtttgcccagaaacgacccgaatcaccattt
aactggtccctttttgccacagacgccactgggctctccaaccccagagcgctcttcgtc
tcccgtcgtggggtggaaaccaaccaaacccgctccatggctggcatgggccaccgaacc
aggtatacccagtccctttccattcgagcacaaaaatctgacactcggccagtgattgca
ctcaagttgctcctcattccggtcgtcctgtacttcaactgggagttcgtcgcgcgatac
gtgtcgcctccactctcgaatcccttcggtcccttcttcctcctctccggttacgttgaa
ggttccaaacccgatgaccctcgttacgcgaaatcatggctggatttcttgttcctcggc
ttctacatcgtgttttggtcaatggtccgccaaaccatcgccgtcaatattgcccgtccc
attgctcgctacttcggtctcaggaaagaagcgaaaatcgacaggttcggagagcaactg
tatgctatgatttattttgccatctgcggtgcatggggctatcgcgtcatgaaacaattg
cccacctactggtaccaaactgagcacttctggatcgctttactagattacccacactgg
gacatgaagggggaattgaagagatactatctcatgcagttctcctactggtgccaacag
tttattgtgctgcttttgggtttggagaagccacgcaaggactactgggaactggtcgcc
caccatttcgtgacaatgtggctggttggctggagttatggcctgaactttaccatcatc
gggagtgccgtttacatgagcatggatattccagactccttcctcgctgcttccaaactt
ttgaactacatgcaatggaacagggcaaagattgtctcatttgttacctttattgctgtt
tggacctacttccgtcactacctcaacttgaagatcctttggtcctgcctctttgagact
caattggttcccgaatcgtccaagatatggtcatttgaaaacggcacttacatggtgaac
tggatgccatttatggttttcgggtccatttttgctctccaaattctcaatctcttctgg
tactacctcatgtggagaattctaatcagggccattattacccgcgaggcggatgacgac
agatcagacgacgaaggcgacgatgatgatgaaccagacaaggaagactaa

DBGET integrated database retrieval system