KEGG   Coprinopsis cinerea: CC1G_00386Help
Entry
CC1G_00386        CDS       T01275                                 

Definition
longevity-assurance protein 1
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
cci  Coprinopsis cinerea
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CC1G_00386
Enzymes [BR:cci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     CC1G_00386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 436 aa AA seqDB search
MTSRNVKGRNGAAPPKIVTAKLDVSPLSNGFAQKRPESPFNWSLFATDATGLSNPRALFV
SRRGVETNQTRSMAGMGHRTRYTQSLSIRAQKSDTRPVIALKLLLIPVVLYFNWEFVARY
VSPPLSNPFGPFFLLSGYVEGSKPDDPRYAKSWLDFLFLGFYIVFWSMVRQTIAVNIARP
IARYFGLRKEAKIDRFGEQLYAMIYFAICGAWGYRVMKQLPTYWYQTEHFWIALLDYPHW
DMKGELKRYYLMQFSYWCQQFIVLLLGLEKPRKDYWELVAHHFVTMWLVGWSYGLNFTII
GSAVYMSMDIPDSFLAASKLLNYMQWNRAKIVSFVTFIAVWTYFRHYLNLKILWSCLFET
QLVPESSKIWSFENGTYMVNWMPFMVFGSIFALQILNLFWYYLMWRILIRAIITREADDD
RSDDEGDDDDEPDKED
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaaggaacgtcaaagggcgcaatggcgctgctccccccaaaatagtcaccgcc
aaattagacgtcagtccgctttctaacgggtttgcccagaaacgacccgaatcaccattt
aactggtccctttttgccacagacgccactgggctctccaaccccagagcgctcttcgtc
tcccgtcgtggggtggaaaccaaccaaacccgctccatggctggcatgggccaccgaacc
aggtatacccagtccctttccattcgagcacaaaaatctgacactcggccagtgattgca
ctcaagttgctcctcattccggtcgtcctgtacttcaactgggagttcgtcgcgcgatac
gtgtcgcctccactctcgaatcccttcggtcccttcttcctcctctccggttacgttgaa
ggttccaaacccgatgaccctcgttacgcgaaatcatggctggatttcttgttcctcggc
ttctacatcgtgttttggtcaatggtccgccaaaccatcgccgtcaatattgcccgtccc
attgctcgctacttcggtctcaggaaagaagcgaaaatcgacaggttcggagagcaactg
tatgctatgatttattttgccatctgcggtgcatggggctatcgcgtcatgaaacaattg
cccacctactggtaccaaactgagcacttctggatcgctttactagattacccacactgg
gacatgaagggggaattgaagagatactatctcatgcagttctcctactggtgccaacag
tttattgtgctgcttttgggtttggagaagccacgcaaggactactgggaactggtcgcc
caccatttcgtgacaatgtggctggttggctggagttatggcctgaactttaccatcatc
gggagtgccgtttacatgagcatggatattccagactccttcctcgctgcttccaaactt
ttgaactacatgcaatggaacagggcaaagattgtctcatttgttacctttattgctgtt
tggacctacttccgtcactacctcaacttgaagatcctttggtcctgcctctttgagact
caattggttcccgaatcgtccaagatatggtcatttgaaaacggcacttacatggtgaac
tggatgccatttatggttttcgggtccatttttgctctccaaattctcaatctcttctgg
tactacctcatgtggagaattctaatcagggccattattacccgcgaggcggatgacgac
agatcagacgacgaaggcgacgatgatgatgaaccagacaaggaagactaa

DBGET integrated database retrieval system