KEGG   Coprinopsis cinerea: CC1G_00541Help
Entry
CC1G_00541        CDS       T01275                                 

Definition
ubiquitin C-terminal hydrolase
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
cci  Coprinopsis cinerea
Brite
Enzymes [BR:cci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CC1G_00541
Peptidases [BR:cci01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CC1G_00541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 944 aa AA seqDB search
MARSKWISFAAQHALNKDSQKSAQPDQPAPSPPPAEVKKFGLENALYFCTPFRDLMLQAS
DSSAPQDCPAIPIASTVNGLGNKHQSRPRQPERKQSTSVIPTESTVGSASQPSATPIPPS
PPTLFSALRSLFIHIATQPGDKGTVAPKAFIDKLKELNDIFRSTMHQDAHEFLNYLLNRI
VEEMEVERKQTRGSVQGEDLSGSIATLGSKAPPTLASSTSGTNARDATLVHRLFEGILTS
ETRCLTCETVSSRDESFLDLSIDIEQNSSVTACLRQFSASEMLCNRNKFFCDACCDLQEA
EKRMKIKKLPNVLALHLKRFKYQEDLGRYIKLTYRVAFPMDLRLFNTVDDMEDADRLYHL
FAIVVHIGNGPHHGHYISIIKNCGTWFVFDDDNVYSIPESDIPKYFGDSNSGSAYVLYYQ
ADDIDLVSLGVQLPEPPEPPPTQEPATDISAGLKPPITLATHVVGHPPGLEPYPPISEEL
DAQDASTTLPAQSLIPEKPTTQLTPVNVTVIPDTADQSPPQPAVSSPSTTRFGNFLNTLR
RAPSASLAKANISATTSTSTTDSRRSVSDRSPRLSASSPSLSVGEDNHSQTPPPPVPPLP
PNILTTAPPTPHTNGEDKEKPKKEGKGWFGKRKSFKAVSKTPTTDSPTAVLPPSPNRRTT
EERPPPPTPSNSNWFRPFGSSQRDSQTSDHGRSRDTLPEGSQSEHLTPRNGHASGGGLSP
YDDIPSTPASTSSSLNSAPVNSPGFSSLRASAPPSTSSSSGSVPKKHNYHHGADRHSSSH
DQHKPKNSRSSSPSNDNRQRPFPSSKKSGDFDRSLPPLPHTPPTTYLNPSSSTENGHLIP
FYSEPEPITSNGYHHHYHQYNVHHNHHQEGGQHSATSQSAPPTSFPEALHQRSTTLPPTS
IASSVGANTSSGSNSSSTSGIRKATRKLSLTAPMLGFGRSKDKK
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atggccaggtccaaatggatctcattcgccgcgcaacatgctctcaacaaggactcccag
aagtccgcgcagccagaccagcctgcgccttctccaccaccagcggaggttaagaagttt
ggcctagagaacgccctatacttctgcacaccctttagggatcttatgctccaggcctcc
gattcctcagcaccacaagactgtccggcaatcccgatcgcgtccacagtaaatggcctc
gggaacaagcaccagagtcggcctcgacagcctgagcggaaacagtcgacctcggttatt
ccaacagagtcaacggtcggctcagcatcccaaccgtctgctacgcccattcccccttcg
ccaccgacactcttctctgcactacggtccttatttatccatatagcaacccagccggga
gacaagggcactgtcgccccgaaagccttcatcgataaactcaaagaactgaacgacata
tttcgatccaccatgcatcaggatgcacacgagtttctcaattatctgctgaataggatt
gtggaggagatggaggtggaaaggaagcagacgcgaggttcggtacagggcgaagatctg
tccggatcaatagctactctaggttccaaagcgccgccaactctcgcaagctcgacttct
gggaccaatgctcgggatgcaaccttggttcatcggctgtttgagggaattctgaccagt
gaaactcgttgccttacttgcgaaacggtatcttcccgagatgaatccttcttggacctg
tccattgatatcgaacaaaactcaagtgttacagcatgtctccgacaatttagcgccagt
gaaatgctttgcaaccgcaacaagtttttctgtgacgcgtgctgcgacttgcaagaggca
gagaaaaggatgaaaattaagaaactccccaatgtcctcgccttacacttgaagcggttc
aagtaccaagaagacctaggccggtacatcaagctgacatatcgagtcgcgtttccgatg
gatcttcgactattcaatactgtggacgacatggaggatgctgaccgcctatatcatctc
tttgcaatcgttgtccatattggcaacggaccgcatcacggccactatatctctataatc
aagaactgtggaacctggttcgtgttcgatgacgataatgtctactcaataccggaaagt
gatatacccaaatactttggcgattccaactccggttctgcgtatgttctctactaccaa
gccgacgacatcgacctggtctctcttggcgtgcaactaccagagcctccagaaccgccg
cccactcaggagcctgcaaccgatatctccgccggattgaaacccccaataacactcgca
acccatgtcgttggacatcctccagggctggagccttatccacccatttccgaggaactc
gatgcacaagacgcctccactacattacctgcacagtccctaatacccgaaaaacctact
acccagctaacgcccgtcaatgtcaccgttattccagacactgccgaccagtcccctccg
cagcctgctgtttcttcaccatccacgacacgcttcggcaacttcctgaatacactgcga
agagccccgtccgcttccctcgccaaggctaacatctctgctaccacaagtaccagcaca
acagacagcagaagatctgtatcggatcgctcccctcggttgtcagcttcttccccgtcg
ctttctgtgggagaagataatcattcccaaacaccacctccccctgtgcccccattaccg
ccaaacattcttactaccgcacctcccactccgcatacaaacggggaagacaaagagaag
ccgaagaaagagggtaaaggctggtttggcaaacggaaatctttcaaggcggtcagcaaa
acgcccaccactgactccccgacggccgtccttccaccgtctcctaatcgccgaactacc
gaagaacgcccacctccacccacaccttctaattcaaattggtttcgtccattcggttct
tcccagcgagatagccaaacctcagatcatgggcgatctagagacactcttcctgagggt
tcacaatccgagcacttaacaccacgaaatggacatgcttctgggggaggattgagtcca
tacgacgacatcccctcgacaccggcatcgacctcctcttcattaaattccgcccctgta
aacagccctggcttttcctcgctgcgagcttccgcccctccatcgacatcatcttcctct
ggttccgttcccaagaaacacaactatcatcatggcgcagaccggcattcatcatcccac
gaccagcacaaacccaaaaattcgcgcagctcctccccttcgaatgataacagacagcgg
cccttcccgtcgtccaagaagtctggtgatttcgaccggtcgctccctccattaccccat
accccacccacaacctacctcaatcccagttcctcgaccgagaacggccatttgatacca
ttctattctgagcctgaacccatcacgtcgaacgggtatcatcaccactatcaccagtac
aacgtccatcacaatcatcatcaagaaggaggtcaacattcagctacatctcagtctgcc
ccgcctacatcctttcctgaagccctacatcaacgaagcacaactctaccgcccacgtct
atcgcttcctctgtcggagcgaatacgagttcgggaagtaattcctcgtcgacgtctggg
attcggaaagcgacgagaaagcttagcttgacggcgccgatgcttgggtttggacgaagt
aaagacaagaagtga

DBGET integrated database retrieval system