KEGG   Coprinopsis cinerea: CC1G_00548Help
Entry
CC1G_00548        CDS       T01275                                 

Definition
(RefSeq) ubiquitin C-terminal hydrolase Ubp2
Organism
cci  Coprinopsis cinerea
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1430 aa AA seqDB search
MEGSDAPKARRPLPTPGVGNGTQQRPSTPVQAAAQRPISPSQFYGTSKPPLPTRPKNPGS
THTTQQRPSTPVQAAAQRPISPSQFYGTSKPPLPTRPKNPGSTHTAYVAPAVSDPPRYGS
PSSAPPGYREPELIVEEPEVEDDTLPDLIPGNDYDWNKSTTNTAASAYGNGWGTEQPPGE
AWSEISSWNQSWDQTGSATGGLYSMDQFNTRRDNEVAIDGRSELEESRWWNEDERVRNGR
PGTGMLAPVVAENMHDPLHSLFSVNIAAIPPAPATAPLPTSSFPASTPTPSESPSSSQAA
ANHVFPTEEEVRAAVPHPNAYYCPKDNGWVLLIWKSSSVAPPVTSSFADSLPNQDRRKRI
QSCVSDAEQSSTSPNKTHHFHRYIKAVDSLKLTTPYREDPWRVEDVMKQKRRGQTVVEDV
HKLKDGLDEKVEQEPEGKLLDLYVCCQCQLYCVVSEVIPGVVPRKHLEEFVRDKRNNPAP
GKSGEVSVSTGMETLLLAIENKIFKGNHRLIKIQSTGFKTKLGWSPNIKRIFEYLGFVEN
TANNDATLMSPNTEIALNRKKLLRAWIELNAWLVDYRKQNSSAFRDPIYSEKKVWVQIDN
AREMYQRGIGAHPDQIQRGVLTPTALTSLRNLDDAWRGLGLTPTTFSADLLAFAYLAQCR
CDPAKTPRYFTWFCDIVKALETSGESSAQLQELMAMEQSRNRFTEMDIHLAAQNLGFGPE
GHLRVDYDDDVDEDFVENAWKDAVKRAYRDPVNGSEMQRTADESLRILAEARGSNRLRQL
WENKKNSMSPERAYDTLEVPADVDDAMLIMVFNMRCEESTSQMDKMREALTVIAEVRDSE
RLRQFLLTNQDPGDITLPTRPDFPRGLNQLGNTCYLNSLLQYFYTIKELRDAVMPMSTLD
IKAIEEEKFSEEDINKHRVGGRRVSRREIIRSRKFIHQLANLFFYMQSSSDSAVTPSLDL
AKLALVTSRDEEEEDEAEKGGSDSSHDSDATLVDGEPSHGAPVNADNSDVAEKNSVLGKR
SRELDANRQGSVMDVDAQDVDGFVMVASPRKGGSPSPMEQDTPPQAGSPSKDKDGDVSMK
PVPARKRADTYDGGMMFGRQHDVAECMDNCMFQIETALLKFGSKTEADSSIIKRLFFGKI
RQRLTSANLTSRASLHEKEDLFSHLPVNVTNDGVDIYDGLSGYFDDVVEYQGGKARMEVS
LVDVPLLLQIQLQRVQFNRETLQPYKSQAYVKFGETIYLDRFMDSADPRKKLRSRTIQRE
LNSCRERIQVLLEGKNGSFASALDRASGYLGSLQQTVPGIEDHLVSELQREKRHVEMEID
NLRVRVDQLKEELETLWGNSKEFPYELTSVFIHRGSSPSFGHYFFYSRHLPQEPDSWFKY
NDSDVSVVSKDEVLQDTTGSTANPYLLVFARKGSNVVETVNRFDPTQLLS
NT seq 4293 nt NT seq  +upstreamnt  +downstreamnt
atggagggttccgatgcacccaaggctcgacggccgctcccaacgcccggggttgggaat
ggaacacagcagagacccagcacacccgtccaagcagcggcccaacgacctatatctcct
tcccaattctacggcaccagcaaaccaccgttaccgacccgtcccaaaaatcctggttcc
acccataccacacagcagagacccagcacacccgtccaagcagcggcccaacgacctata
tctccttcccaattctacggcaccagcaaaccaccgttaccgacccgtcccaaaaatcct
ggttccacccataccgcttacgtcgccccagcagtctcggatccaccgcggtatggctcg
ccatcctccgcaccgccaggctatcgagagcccgagttgatcgtcgaagaaccagaggtg
gaggacgacacgctaccagaccttatacccggcaacgattatgattggaacaaaagcaca
accaacactgcagcttcggcttacggcaatgggtggggcactgaacaaccgcccggggag
gcttggagtgagatctcgagttggaaccaatcctgggaccagacagggagtgcgaccggc
ggcctttattccatggatcagttcaacacacgacgcgataacgaggttgcgattgacggc
cgtagcgagctggaagaatccaggtggtggaatgaggatgagcgcgtcaggaatggccgt
ccaggcactggcatgttggcacccgtcgtggcggagaacatgcacgaccctctccattca
ttattctccgttaacattgctgcgatcccaccagccccggcgacggccccattgcctacc
agttcgttccctgcgtctacacccactccatctgagtccccgtcttcatcacaagctgct
gccaatcacgtctttccgactgaagaagaagttcgagcagcagttcctcatcccaacgct
tactactgtccaaaggataatggatgggttcttctcatttggaaatcctcgagcgttgcc
ccaccagtaacgagcagtttcgcggacagccttcccaatcaagaccgccgcaaacggatt
caatcctgcgtttccgacgcagaacaatcctcgacgtcacccaacaaaactcaccacttc
catcgatatatcaaggccgtcgattcattgaaactcacaactccttaccgcgaagatcca
tggcgggtcgaagatgttatgaaacagaagaggagaggccaaacagtcgtcgaagatgtg
cacaaactcaaggacgggctcgacgaaaaggtcgagcaggagcccgaaggcaaactattg
gatctctacgtttgctgccaatgccaactctattgtgtggtgtcggaagtcatccccgga
gttgttcctcgaaaacacttggaagagtttgttcgagataaacgcaacaatcccgctcct
ggaaagagcggagaggtgtctgtctccacaggcatggagacgttactgcttgccatcgaa
aacaagattttcaaaggcaaccatcgtttgatcaagattcagagtacagggtttaagacg
aagttgggctggagccccaacatcaaacgcattttcgaatatctgggtttcgtggagaac
accgccaacaatgatgctacactcatgtcgccgaacactgaaatcgctctcaatcggaag
aagctcttaagagcttggatcgaactcaatgcttggttagtggattacagaaaacaaaac
agttctgccttccgcgatccaatctacagtgaaaagaaggtttgggtccagattgataat
gcgagggagatgtatcagaggggcattggtgcccatcctgaccagattcaacggggcgta
cttactccgaccgcgttgacgtctcttcgcaacctcgacgatgcttggagaggccttggc
cttactcctacgaccttttctgctgacctcctcgcattcgcctacctcgcacaatgccgc
tgtgaccccgccaagactcctcgttacttcacttggttctgtgacatcgtgaaggccctg
gaaacttccggagaaagcagcgctcagttacaagagctcatggccatggagcaatctcgc
aaccgattcaccgagatggacatccaccttgctgcccagaaccttgggtttggacctgaa
ggccatctgcgagtcgattatgacgacgacgttgatgaagatttcgtggaaaatgcctgg
aaggatgctgttaagcgggcatacagggaccccgtcaatggttctgaaatgcaaaggacg
gcagacgagtctctgcgaatcttagcggaagcgaggggaagcaaccggttgaggcagctt
tgggaaaacaagaagaatagcatgagtcctgagagggcttatgatacgctggaagtcccg
gctgacgtggatgatgccatgctcatcatggtcttcaatatgcggtgcgaggaatcgacg
tcgcaaatggacaagatgcgggaagcgttgactgtcattgctgaagttcgggatagcgaa
cggttacgccagttccttctaaccaaccaagatccgggtgacatcactctaccgacacgt
ccggatttccctcgaggtctcaatcagcttggaaatacctgctatctgaactccctactc
cagtatttctacaccatcaaagagcttcgggatgctgttatgcccatgtccacgcttgat
atcaaggcgattgaagaggagaagttttccgaagaggatatcaacaagcatcgagttgga
ggtcgtcgtgttagtcgacgcgagattatccgttcacgaaaattcatccaccaacttgcc
aacctcttcttctacatgcaatcctcctccgactcggcggtaaccccaagcctggaccta
gctaaactagcgctcgtcacgtctcgagacgaggaagaagaagacgaagcagagaagggt
gggtccgactcctctcacgactccgatgcgactctggttgatggagagccatctcacggt
gccccagtaaacgcggacaacagtgatgtcgccgagaagaactcagtgttgggcaagcgg
agtagggagttggatgcaaataggcagggcagtgtgatggatgtggatgcgcaggatgtg
gacgggtttgtgatggttgcgtccccgaggaaggggggttcgccttcgccgatggaacag
gacacaccaccacaggcgggttcgccgtcgaaggacaaagacggggatgtttctatgaag
cctgtacctgcgaggaagagggcagacacatatgatggcggaatgatgtttggcagacaa
cacgacgttgcggagtgcatggataactgcatgttccagatcgagactgcgctgttgaag
tttggttcaaagaccgaggcagattcgagtatcatcaagaggctattctttggcaagatc
cgccaacggttaacctctgccaacttgacctcccgtgcatcactacacgaaaaggaagat
ctcttttcacatcttcccgttaatgtcaccaacgacggcgtcgatatctatgacggtttg
agcggttactttgacgatgtcgtggagtatcagggtggaaaggccaggatggaagtctct
ttggttgatgtccctctacttctccagatccaacttcaacgagtgcaattcaacagggaa
acactgcagccctacaagtcccaggcatatgtcaagttcggtgaaacgatctatctagac
cgattcatggatagtgccgaccctcgcaagaagctcaggtctaggaccattcaacgcgaa
ctgaattcctgtcgggagaggatacaggtcttgctcgagggaaagaacggatcctttgcc
tcagcattggaccgagcctctggctatcttggttctctccaacaaaccgtccctggaatc
gaagaccacctcgtcagtgaattgcaacgggagaagcgtcatgtcgagatggagatcgac
aatctccgagtccgcgtggatcaactgaaagaggagttggagacactttgggggaacagc
aaagagttcccatatgagctcacgtccgtcttcatccatcgtggaagttcaccgtcattt
ggccattacttcttctattctcgacatctccctcaagaacccgactcttggttcaagtac
aatgactcggacgttagtgttgtttccaaggatgaggtccttcaggatactaccggttcg
actgcaaacccgtaccttcttgtattcgctcgtaaaggctccaacgttgttgaaaccgtc
aatcgcttcgatcctacgcagctcctttcatga

DBGET integrated database retrieval system