KEGG   Coprinopsis cinerea: CC1G_00577Help
Entry
CC1G_00577        CDS       T01275                                 

Definition
CMGC/MAPK protein kinase
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
cci  Coprinopsis cinerea
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cci00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CC1G_00577
Enzymes [BR:cci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CC1G_00577
Protein kinases [BR:cci01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CC1G_00577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 368 aa AA seqDB search
MSFVKLSIFGTSFEVTTRYVDLQPVGMGAFGLVCSAKDQLTGASVAIKKIMKPFSTPVLA
KRTYRELKLLKHIQHENIISLSDVFISPLEDLYFVTELLGTDLHRLLTSRPLEKQFIQYF
LYQILRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYRA
PEIMLTWQKYDVAVDIWSTGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVIETI
CSENTLRFVQSLPKRQRVPFSQKLRTTDPDALDLLERMLVFDPRKRINASESLAHAYVAP
YHDPTDEPEAEEKFDWSFNDADLPIDTWKVMMYSEILDFHQVDQGQGLGIPEGALAGPED
GGYSNGHA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcgtcaaactcagcatattcggaacatccttcgaggttacaactcgatatgtt
gacctccagccagtgggaatgggcgctttcggtctcgtctgctcagcgaaagatcaacta
acaggagcatctgtcgctatcaagaagatcatgaaacctttcagcacaccggtcctcgcc
aagcgaacgtaccgcgaactcaagctcttgaagcacatccaacacgaaaacattatcagc
ctcagcgacgtcttcatctccccactggaggatctgtactttgtcacagagctcctcgga
actgaccttcaccgcctgttaacgtcgagaccactcgaaaagcagttcattcaatacttc
ttgtaccaaatcttgcgtggcctaaaatacgttcattcagcgggtgtcgtccatcgtgac
ctcaaaccgagcaatatcctcgtgaacgaaaactgtgatctgaagatttgcgatttcgga
ttggctcgtatccaggatccgcaaatgactggctacgtctcgacacgatactaccgggcg
ccagagatcatgctaacatggcagaagtatgacgttgccgtcgacatctggagtactggg
tgcatatttgcagagatgcttgagggcaaaccgctcttcccagggaaagatcacgttaac
caattctcgatcatcacggaattattgggcacacctcctgatgatgtcattgaaaccatc
tgcagcgaaaacaccctgcgctttgtccaaagcttgcctaagcggcaacgtgttcctttc
agccagaaactgcggacgacagacccagatgcacttgatctccttgagcggatgctcgtg
ttcgacccgcgcaagcggataaacgcgtctgagtcacttgctcatgcctacgtcgcacct
tatcatgatcctaccgacgagccggaagcggaagagaaatttgattggagcttcaatgac
gccgatcttcctatcgatacctggaaagtcatgatgtacagtgaaatcctcgacttccat
caggtcgatcaagggcaggggctgggcatcccagaaggagcgctggctggtccagaggat
gggggctactcgaatggccatgcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system