KEGG   Coprinopsis cinerea: CC1G_00577Help
Entry
CC1G_00577        CDS       T01275                                 

Definition
CMGC/MAPK protein kinase
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
cci  Coprinopsis cinerea
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:cci04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 368 aa AA seqDB search
MSFVKLSIFGTSFEVTTRYVDLQPVGMGAFGLVCSAKDQLTGASVAIKKIMKPFSTPVLA
KRTYRELKLLKHIQHENIISLSDVFISPLEDLYFVTELLGTDLHRLLTSRPLEKQFIQYF
LYQILRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYRA
PEIMLTWQKYDVAVDIWSTGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVIETI
CSENTLRFVQSLPKRQRVPFSQKLRTTDPDALDLLERMLVFDPRKRINASESLAHAYVAP
YHDPTDEPEAEEKFDWSFNDADLPIDTWKVMMYSEILDFHQVDQGQGLGIPEGALAGPED
GGYSNGHA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcgtcaaactcagcatattcggaacatccttcgaggttacaactcgatatgtt
gacctccagccagtgggaatgggcgctttcggtctcgtctgctcagcgaaagatcaacta
acaggagcatctgtcgctatcaagaagatcatgaaacctttcagcacaccggtcctcgcc
aagcgaacgtaccgcgaactcaagctcttgaagcacatccaacacgaaaacattatcagc
ctcagcgacgtcttcatctccccactggaggatctgtactttgtcacagagctcctcgga
actgaccttcaccgcctgttaacgtcgagaccactcgaaaagcagttcattcaatacttc
ttgtaccaaatcttgcgtggcctaaaatacgttcattcagcgggtgtcgtccatcgtgac
ctcaaaccgagcaatatcctcgtgaacgaaaactgtgatctgaagatttgcgatttcgga
ttggctcgtatccaggatccgcaaatgactggctacgtctcgacacgatactaccgggcg
ccagagatcatgctaacatggcagaagtatgacgttgccgtcgacatctggagtactggg
tgcatatttgcagagatgcttgagggcaaaccgctcttcccagggaaagatcacgttaac
caattctcgatcatcacggaattattgggcacacctcctgatgatgtcattgaaaccatc
tgcagcgaaaacaccctgcgctttgtccaaagcttgcctaagcggcaacgtgttcctttc
agccagaaactgcggacgacagacccagatgcacttgatctccttgagcggatgctcgtg
ttcgacccgcgcaagcggataaacgcgtctgagtcacttgctcatgcctacgtcgcacct
tatcatgatcctaccgacgagccggaagcggaagagaaatttgattggagcttcaatgac
gccgatcttcctatcgatacctggaaagtcatgatgtacagtgaaatcctcgacttccat
caggtcgatcaagggcaggggctgggcatcccagaaggagcgctggctggtccagaggat
gggggctactcgaatggccatgcttga

DBGET integrated database retrieval system