KEGG   Coprinopsis cinerea: CC1G_00662Help
Entry
CC1G_00662        CDS       T01275                                 

Definition
mip1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
cci  Coprinopsis cinerea
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1549 aa AA seqDB search
MQDSGVHMPRKGGSKFTTEPWHKSSGSRLRSEDSDSDTERDYRSHSRSDPSSQSRPERGR
HRTRSPHSRPNGSVKTLDSAPPIPYWSAKRHLTCGNPTPGPPWSQKPVQWRGSTPGRLKT
AAAALVMCLNIDVDPPDIVKTNPCAVLECWVDPRTMPTHKALEHIGSNLQHQFEGLSLKI
QYKPILDPSFEDLKRFVTQLRRQAGQDALLFYYNGHGVPKPTASGELWCFNRNYTQYIPV
SLQELQSWVGSPGVYIWDCSAAGHLLQNFNMFAERRDQEAIMHGGYPDGRQPFMNSLQLA
ACAAHEQLPSCPELPADVFTSCLTSPIDIALRYFIMTHQLPNNITADMVVQLPGDLKDRR
TPLGELNWIFTAITDTIAWTTFSREIFTKLYRSDLLIASLFRNFLLAERIMKNYHCTPHT
WPPLPPTNTHPLWATWDLAVDTCLRQLPDLLFKGGVTGGHLANVGTRPGKIGSTSRQDPN
AIPARGSDKPYVYQPSRFFADQLTAFEVWISRGGSALTRKGPLSLPQATDRAGNPEEPNP
RSEYDGVPSHLVPRKPPDQLPIVLQVLLSQPHRLRALILLSQFVDLGPWAVHLVLTIGIF
PYISKLLQAAGQDLRPVLIFIWARILAVDPSVQHDLWNSGGYKYFANILAIKNDDVLPNS
SEHKAMCAFILSAISRDFPPGQEACLRDGVFDNCYDRLDESDFLLRQWTALCIGQIWDGN
DENKVYGVDNGTQDKLIAMLSDDSAEVRCAALFALGTFLGASGSSDPNKQGGGGSGTMYQ
LEERVHFRMEVAVVTGATLAIKDDASPMCRKELLVVISTLVKEWRGCFVVCAWLYWEEDR
KWRTTGAPYSADDELTSHAVAEWLDGFDDESLREEKRVLLSSFFTIFVVLLDLSVDPYQE
VATNAQTIVDYIMALLLESPFTKLPSSTLHAAPWSPDDPRGSPQMAARSRTSLYQPGSPH
PASPIRSDRPGLTRTDTMTSTISSGVTNTLRRTSSFANALKSLAFSTIDDGRTSSSIPSS
SQLKRDPLDYSRPPSPNLNVAQYASPYSRPTTPPGTPHHHRPVSLQNSYENLQPQVNFSA
ADVMEALTEEDMERLRARRRASNHGRPRHHGGMPSPSNSTFSTDSNSSVILGLGTGASIR
DTLPLKSTYFDWCCEYFKEPQMRQAEPDEPGSIQYNHQVWRQQRNEQVLVETATQIAVSE
TCRWDRPVAHFQIAGHPLTMVFHSYDQHLFVANEHDMIGVWDWSQRKRLKYFCNGNPRGT
TITSLEVINQDVGGIILTGASDGIVRLFRNYDPTVDQGPLQMVSAFRGLNEMIQMRQGSG
MVMDWRQSAGTLLVGGDSRVIKVWDAQTETQGMDLDTNSDSPVTAICSDHVSNQTFIASF
ADGVVKIFDRRLEDEDAIVRTYVDHTSWVQNVRWHPRLGGRFLSASVDGQVKVWDLRGAD
MATKTWDIQAHGLSAFDVHPTSCVFATSSAVSPTQWKAQRVSVHTIDKAIHLSSINAPTG
LSAYPIRPMPSPYIPRSTSLVFHPTEMLYGVGEPDGSIRVMGCKFPPAQ
NT seq 4650 nt NT seq  +upstreamnt  +downstreamnt
atgcaggattcaggtgtacacatgccgaggaaaggaggtagtaaattcacaacggaacca
tggcacaagtcctcaggctcacgactacgaagcgaagattcagattcggatacagaacga
gactatagatcgcactcgcgctcagacccgtcctcccaatctcgaccagagcgcggacga
cacagaacacgaagtccccacagtcgcccaaatggttccgtgaaaaccctggacagtgct
ccaccaatcccctactggtccgcaaaacgacatttaacctgcggaaatccgactccggga
ccgccatggtctcagaaaccagtgcagtggagaggatcgactcccgggcgtctcaagacc
gcagcagcagcgcttgtgatgtgcctcaatattgacgtcgacccaccagacattgtcaag
accaacccttgtgccgttttagaatgctgggtcgatccccgtactatgcccacccacaaa
gctttggaacacattggttcaaatctccagcaccaattcgagggcctcagtctgaagatc
cagtacaaacctatccttgatccctccttcgaagacctcaagcgttttgtcactcaattg
cgccgtcaagcgggtcaagatgcgttgctattctattataacggtcacggtgtccccaag
cctacagcgagtggcgaactctggtgtttcaaccgaaactacactcaatacataccggtg
tccctacaggagctgcaatcgtgggtgggatcgccgggagtttacatttgggactgctct
gcagccggacatctcttgcaaaactttaacatgtttgcagagaggcgggaccaagaggct
atcatgcacggcggttatccagacggtcgccagcccttcatgaactcccttcagctagcg
gcttgtgctgcgcatgaacaactcccctcttgtcccgaacttccagccgatgtcttcacc
tcatgtctcacctcccccatcgacatcgcacttcgttattttatcatgacccaccaactc
cccaacaacatcaccgccgacatggtcgtccaactccccggagatctaaaagacaggcga
acgccactgggcgaactaaattggatctttacagccatcacggacaccattgcttggacg
acgttttcgagggagattttcaccaaactctaccgatccgaccttttgatcgcctccctc
ttccgcaatttcctactcgcagaacgaattatgaaaaactatcactgcacaccccacaca
tggccacctctcccgcctaccaatacccaccctctttgggcgacatgggatttagctgtc
gacacatgtttacgtcaattgccggatcttcttttcaagggaggagtgactggcggccat
ctcgcgaacgttgggacaagacccgggaagattggttcgacctcgcgacaagaccccaac
gcgatcccagccagaggctctgacaagccatacgtctatcagcccagccgattcttcgcc
gaccaactcactgcattcgaagtatggatttcgcgaggtggctcagcgttgacgaggaag
ggtcctctctcactcccccaagcaactgatcgggcaggaaatccggaggaacccaaccca
aggagcgagtacgacggggttccaagtcacctcgttcctaggaaacccccggaccaactc
ccaatcgtccttcaagtgctgctgtcccaaccccacaggttgcgggcgcttatccttcta
tcccaattcgttgatcttggaccatgggcagtgcatctcgtccttactatcggcatcttc
ccatatatctccaaactgcttcaagcagcgggacaggatctccgtccagtgctcatcttt
atctgggcgcgaattctcgcagtcgatccatctgtccaacacgacctgtggaattcggga
ggatacaaatatttcgccaacatcctcgccatcaagaacgatgatgtccttcccaatagc
tcggagcataaggcaatgtgcgctttcatcctctccgccatttcgagagatttccctcca
ggtcaagaagcctgccttcgggacggcgttttcgacaactgctacgaccgccttgacgaa
tcagacttcctgctgaggcaatggactgccttgtgtatcggtcaaatctgggatgggaac
gacgagaacaaggtgtacggagtggataacgggacccaggacaagctcattgcgatgctg
tcagacgactcggctgaagtcagatgcgcagcgctatttgcgttgggcactttccttggc
gcgagcggctcatcggatcctaacaaacagggcggcggtggatcgggaacgatgtatcaa
ctcgaggagcgtgttcacttcaggatggaggttgctgtcgttacaggtgcaaccctcgcc
atcaaggacgatgcaagccctatgtgtcgaaaggaattgttggtcgtgatcagcaccctc
gtcaaggagtggcgcggatgcttcgtggtttgtgcgtggttgtattgggaggaggatagg
aagtggaggacgactggtgcgccttactctgcggacgatgagttgaccagccacgccgtc
gcggaatggttggacggattcgacgacgaatctctccgggaagagaagcgggtgcttttg
tcttctttcttcaccatctttgtcgttctgctcgacctctcggttgacccatatcaagag
gtcgcaacgaacgcccaaacgatcgtcgactacatcatggctctcctcctcgagtctcct
ttcaccaagttaccgagctcgactctccatgctgcaccttggtcacccgatgatcctaga
gggtcacctcaaatggccgctcgatcccgtacctcgctttaccagccgggttcccctcac
cctgcctcacccatccgcagcgatcggccgggcctgacccgtacagataccatgactagc
acgatctcgtctggtgtcacgaacacacttcgccggacgtcgtccttcgccaatgcgctc
aagtctttggcgttctccaccattgacgatggccgaacatcaagttccatcccttcctca
tcccagttgaaacgcgaccctcttgattactccagaccaccctctcccaatctcaacgtc
gcgcaatacgcgtctccttattcccgtcccaccacccctcctggtacccctcaccaccat
aggccagtgagccttcagaactcctacgagaacctccagcctcaggtcaacttttccgcg
gcggacgtgatggaggctctcacagaggaagacatggagcgtctgagggccaggagacgg
gcgtctaatcacggccgaccgcgccatcatggtggtatgcccagcccgagcaacagcacc
ttctccacggattccaacagcagcgtgatcctcggtttgggaactggtgcgagtatccgc
gatacgctcccactcaagagtacctactttgattggtgttgcgagtatttcaaggaaccg
cagatgaggcaagcggagccggatgaacctggtagcattcagtataaccaccaggtttgg
aggcaacagaggaatgaacaggttctcgtggaaacagccacacagatcgctgtctctgaa
acatgccgctgggatcgaccagttgcgcatttccaaatcgctggccatccgttgacgatg
gtgttccattcatacgaccaacacctcttcgtggcgaacgaacatgatatgattggtgtc
tgggactggtctcaacgcaagcgcctcaagtatttctgcaacgggaaccctcgaggcacg
accattacttcgctcgaagtcatcaatcaagatgttggtggcattattcttactggagcg
tcggatggcattgtcaggcttttcaggaactacgacccgaccgtggatcaggggcctttg
cagatggtcagcgctttcaggggtttgaacgagatgatccagatgcgtcaaggaagcggc
atggtcatggactggcgacagtctgctggaacgcttctggtgggtggcgactcgcgcgta
atcaaagtctgggacgcgcagacggaaacgcagggaatggatttggataccaactctgac
agtcctgtcactgccatttgctcggaccacgtttccaatcagacgtttatcgccagtttc
gccgatggcgtcgtcaagattttcgatcgccgacttgaagacgaggatgcaatcgtacgg
acgtacgttgatcatacctcgtgggtgcagaacgtgcgatggcacccaagacttggtggc
cgattcctctccgctagtgtggatggacaagtcaaagtgtgggacttgcgtggtgcagat
atggcgaccaagacatgggatatccaggcccatggtctctcagcgttcgatgtccaccca
acatcctgcgtattcgctacttcgtccgccgtctcacctacgcaatggaaggcccaacgc
gtctcggtacatacgattgacaaggcgattcacctctcttctatcaacgcccccaccggg
ctcagtgcataccccatccggccaatgccatccccttatataccccgttctacctctctc
gttttccatcctacagaaatgctctatggtgtcggcgaacctgacggctccattcgtgtg
atgggatgcaagttccctcccgctcagtga

DBGET integrated database retrieval system