KEGG   Coprinopsis cinerea: CC1G_00775Help
Entry
CC1G_00775        CDS       T01275                                 

Definition
ubiquitin carboxyl-terminal hydrolase 4
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
cci  Coprinopsis cinerea
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cci00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CC1G_00775
Enzymes [BR:cci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CC1G_00775
Peptidases [BR:cci01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CC1G_00775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 1108 aa AA seqDB search
MSSANSSNGPKSQDAMSVSEIKAKAKEAVQKEGRRASAMSLIKTARAQLQNAKDFEVKGD
LKSALASFIKTASLMKMAMDSPEFSQLPIREAWNDLVTGDCKDLTQRTRAVEEKLKAIEK
QAADAAQNDGPEIKAGGSIAERVRALQDSGLSVGTAKRFSREVANLPTPPTSPSRITTAN
SNPVISSIVPPTPVSPSPHTLVSPSSFGPPSPSSSPSSSPQFDIQGFSQTFPSIDELDEH
PAFSLPSVPTGINGEIHKPTPKPLANGDAGPSPLTSFRNYAVHIERPSSTPIPPIGNSFA
SRPGSPSRSPFKPSNLTSSSTPKIQIPNTNSALPKDLLNYIREYNVLLIDVRNREDFDKE
HIKASAVICVEPTILKREHVNADSIEDAMVIAPRGESSLFENRDKFDLVAVYDQSSKSFG
DANSPLSILVRIISEQAFKKMLKRMPMMLIGGIDAWKRDLGGAELVKGESAPIDVPRTNS
GAPASSAPGSTEAPKAASPSSPNPNNPFTSPMFSAYAAGALPSTSPDPHQVWTPRPSLNG
HVPSFSLDTSAHSRSPADHSPSLQNGTSNLTRRPAMVRPASSSISLSRSRSDLPISPLAA
PQLNGHSSGPISYPSFPRRISPTASGSAPPTSFQPPPAFDIASPPQASINPSTLSRRRSD
YVDQSQEALSALQARSPIDYPELSNQILRPPPLAAAPGLDRQDNRPRVQHATSPFSANSM
LQAPKAPRINSDYPPTYWTDVQIGTSGLKNLGNTCYMNAPIQCLSATVPFARFFTEGRWK
TAINYTNSLGSQGRLVQAFAKLVHEMWGGDLPYLTPMDFRKSICQLNQQYIGSDQHDSQE
FLSFLLDGVHEDLNRVMVKPKIVVTPEQEAELERLPPMIASDREWRNWKARNDSIIVDFF
QGQFRSRLQCLTCEKTSTTYNVFSILQVPIPNSRSSKVPLQRCLDALFNEEVLEKDDAWD
CPQCKTKRRASKTLSLARLPPILLIHLKRFEANGRFSDKIDTFVEFPMKSLDLTNYMPPP
LPPGADKSEINGGVPMSLEDPRTQVPPYKYDLYGVTNHYGNLSSGHYTAYIASRGGWMLC
DDSSVKPIDPRQVVNQKAYVLFYKRVRA
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagccaattcttccaacggacctaaatcccaggatgcaatgtcagtctccgaa
atcaaggcaaaggccaaggaggccgttcagaaggaaggtcgtcgagcgtctgctatgtca
ctcatcaaaaccgcccgggcccaactgcagaatgccaaagactttgaggtcaagggcgac
ctgaagagtgctctggcatcctttatcaagactgcgagcttaatgaagatggccatggat
tccccagagttctcccaattacccattcgcgaggcgtggaatgacctggtcacaggcgac
tgcaaggacttgacgcaacggacgagggcggtggaggagaaattaaaggcgatcgaaaag
caggcggccgacgctgctcagaacgatggtcctgaaatcaaggctggtggttcaatagct
gaacgagtacgagctcttcaagatagtggattgtcggtaggaactgcgaagcgattctca
cgcgaagtagcgaatctaccaacgcctcccacctccccgtcccgcatcacaacagctaac
tcgaacccagtaatctcctcaattgtcccgccaacacctgtctctccctccccgcatacc
ctggtttcgccctcaagcttcggtccgccatcaccgtcttcgtccccgtcctcttcgccg
cagtttgacattcagggcttctcgcagacattcccttcaatcgatgaattggacgaacat
ccagctttctcacttccgtccgtacccacaggcatcaatggagaaatacacaagcctacg
ccgaagccccttgctaacggcgatgctgggccctcacccttgacatcatttcggaactac
gcagtacacattgagaggccgtccagtacacctattccaccaatcggcaattccttcgca
agtcgacctggctctccatctcgatctcccttcaagccgtccaacctaacatcatcctca
actcccaaaatccaaattcccaatactaattcagccctgcccaaggaccttttaaattat
atccgcgagtacaacgtcttgttaatcgacgttcgcaatcgagaggattttgacaaggag
catatcaaggcctctgccgtcatctgtgttgagcctaccattctgaaacgggaacatgtc
aacgcagattctattgaggatgccatggttatcgctccccgcggtgaaagcagtctgttc
gagaaccgtgacaagtttgatctcgtcgcagtttacgaccagtcgtccaagtccttcggc
gatgcaaacagtcccctctccatcctcgttcggatcatcagcgaacaagctttcaagaag
atgctgaagcggatgcccatgatgctcattggtggcatagacgcttggaagcgggacctg
ggtggggctgagctggtcaagggtgaatcggcaccgatagatgtcccgcgaactaattcc
ggcgcgccagcatcgagcgcacctggttccacggaagcgccgaaggcagcatcgccttca
agtccgaaccccaacaacccgttcaccagccccatgtttagcgcttatgccgcgggtgca
ctccccagtacttctcccgatccgcatcaagtctggacgcctcgaccgagcttgaacggc
catgtaccatcgttctcattagacacttctgcacattcaaggtctccggccgaccactct
ccttccctacagaatggcacatccaatttgacacgccgcccagctatggtgcgaccagca
tcaagctcgatatccttgtcccggagcagatctgaccttccgatatcaccacttgctgct
cctcaactcaatggtcattcttcaggaccaatatcatacccctcatttcctcgtcgtata
tccccaaccgcttctggttcagcacctccaacttctttccaacctccgcccgcattcgat
attgcatcacccccacaagcatccatcaacccatccacactctcgcgtagacgcagcgat
tatgttgaccagtcacaagaagccctttctgcgctccaagcacgtagtcccattgactat
cccgagctgtcaaaccaaatccttcgacctccacctttggcagctgctcctggtcttgac
aggcaagacaaccgaccaagagtgcaacatgctacctcgcctttctctgccaactcgatg
ttgcaagcacccaaagctccgcgcataaactcggactatccgcctacctattggacggat
gtgcagattgggacgtcaggattgaagaacttggggaacacatgttatatgaatgcgccg
atacagtgtctgagtgcgactgtgccgtttgcgcggttcttcactgagggccggtggaag
actgccatcaattatacaaattcccttgggtctcagggtaggctagtgcaggcgtttgcc
aaactggtacacgagatgtggggaggtgaccttccatatctcacaccgatggattttagg
aaatccatctgccaactgaaccaacaatacatcggctccgaccagcatgattcccaagaa
ttcctcagcttcttgttagatggggttcacgaagacttgaaccgggtgatggtaaagccc
aagattgtcgtcacaccggaacaggaggcagagttggagaggttgccgccgatgattgcg
agtgatagggaatggaggaattggaaagcgaggaatgatagcattatcgttgatttcttc
cagggacagtttaggagtcggttacagtgtttgacttgtgagaagacttcgacgacgtat
aatgttttctccattcttcaagttccgattccgaatagtcgaagttcgaaggtgccactg
caacgttgtttggacgcgttgtttaatgaggaggtgttggagaaggatgatgcttgggat
tgtcctcaatgcaagaccaagcgaagagcgtccaagaccctttccctcgcccgcttaccg
cccatcctcctcatccacctcaagcgcttcgaagccaacggcaggttctctgacaaaatt
gacacctttgtcgaattccctatgaagtcgctcgatcttacgaattacatgcctccgcca
ctccctcctggtgctgataaatccgagattaacggcggagtacccatgtcacttgaggac
ccgcgtacacaggtccctccctacaagtacgatctgtacggcgtgaccaaccattatggc
aacctgagcagtggccattataccgcatacatcgcctcccgcggagggtggatgctctgt
gacgacagcagcgtcaaacccattgatccaagacaggtcgtgaaccaaaaggcgtatgtc
cttttctacaagagagttcgcgcgtaa

DBGET integrated database retrieval system