KEGG   Coprinopsis cinerea: CC1G_00857Help
Entry
CC1G_00857        CDS       T01275                                 

Definition
ubiquitin-specific protease
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
cci  Coprinopsis cinerea
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 1315 aa AA seqDB search
MTSLPSPASSPSLTPSDSTAQLNSNRKRQRSRSMQSDTSTASVKRSVSEGNSLESVRSDQ
MSSLTIADSNQDIDAYMAEQGEADIPQTLSLTPPPEGATQSTMSTSDEWSLSASEKWQLV
DRAKNKPMTAGETWYLVSREWWKLWARAVGGLSDKEAPVPENEVGPVDNSPLLDASGRLT
PGVVEGVQVEFVPAEVWSHFDSWYGPANHAIPRRVIERGMFGTTTVLELYPAEIKVFRLS
RDSAEKAAAGPHYPTIQVSMGDTLKDLCTRVADAVKIDPTVDTPYRVWRPTAVPDDWRSI
DFPTSSLEDADAKVIDESPHLLENQNIMSGDAFIVEFKQPDGWLIDTQAAAKKPVAAIEP
PPPLFDSKNSFFNRLGTSSSTVATTKASTELSTAFTKPTISINKSSFTKTLEPGTLGLGN
MGNTCFMNSALQCLAHTKELTEYFLNGVFKAELNRDNPLGMQGQIAEVFGALLERIWASS
GPSTSYSPREFKQTLQRFAPQFSGYQQHDSQELVAFLLDGLHEDLNRVIKKPYVEKPDWE
GGGDAELVKLAAKSWEGYMLRNDSVIVDLFQGQYQSTLVCPECEKISITFDPFMYLTLPL
PVQKKWKHTIFYVPWDLEKPHVKVPIEINRDSSFRDLRNVLGRWVGAIPENLLMLEIFQH
KFYKLLDDSLPVNEMSETDVIVCFELPCNARMNRTYKKKEDDPFILPLFLCDAKPTATRG
FTYRSGPSLFGYPAIVVVDRGQATTVDAIYDAVITRLQRWTKNARDLYDWEVSSEPISEV
SIPVPGFPPLETVTEITPTAEGEVVVQPSAEESVIVDEKNMVVDEEAPSDDVELEVGTPR
PYRTKKDVFTLKIYTNQKEYGAGYGTYSRTEEWATWEHRLADQETGIDPFLIRQDDALYA
EFDENMKAYYFGDSKLENARWDEREWEEFVHPELAANQKADSLKQRRGITLQDCLEEFVK
EEQLGEDDLWYCPSCKKHQQATKKFDLWKAPDILVVHLKRFSNNRILRDKIDTFVDFPVE
GLDLGDKVGERAVATRLKEQGVELEELKTVNLDEPLVYDLFAVDEHMGGLGGGHYRAYAS
NHLTGKWYHFDDGYVKQASAEESVNSNAYLLFYRRRSSKPLGGETYQRAMQKKPQVEPSL
DDSESTEINLDDSGLPTPPSEGDATFIGPSDRFSPSSSTLPFADYWNRSNPTSSGPSPPN
DDPPTFEDAQSDPLVIPDVHESFAYDSGIYMSSYRRTSPTSSNEAEADGAESFWDELVDS
GRNSPSWEKGSRFASPSHSESQSSDLNLNPFDDQNVQRIELDDDVKDEADVTKRA
NT seq 3948 nt NT seq  +upstreamnt  +downstreamnt
atgacctctttgccgtcgcccgcgagttcgccatcgctgacgccatcagattcgaccgcc
caactcaactcaaaccgcaaaagacagcgtagccgctcgatgcagtcagacacttccacc
gcctccgttaagcgttcggtttccgaaggaaattccctcgaatcggttcgctcagaccag
atgtccagtctgacaatcgcagactcgaaccaggacattgatgcatacatggcggagcag
ggagaggccgatattccacaaactctttctttgacacctccgcccgaaggcgccacacag
tcgacgatgtctacctcggacgaatggtcgttatcggcatcggagaagtggcaattggtg
gatagggcaaagaataaaccaatgaccgcaggcgagacctggtatctggtgtccagagaa
tggtggaaactctgggccagggctgtcggcggcctctcagacaaagaagctccagtcccg
gaaaacgaagtaggacccgttgacaattcacctctgctcgatgcctccggtagactcaca
ccaggcgttgttgaaggtgtccaggtagagttcgtccccgcagaagtttggtcccacttc
gattcctggtacggtcctgcaaatcacgcaatccctcggcgagttatcgagcgaggcatg
tttgggactacgaccgtcctcgagctatatcccgcagagatcaaggtcttccggctatct
cgcgattccgctgaaaaggctgccgctgggccccattatccgaccatccaagtctccatg
ggcgatacgctcaaggatctatgcaccagggtcgccgatgcagtcaagatcgatccgacg
gtcgataccccatatcgcgtctggagacccaccgctgttccggacgactggcgaagcatc
gacttcccaacgtcctctcttgaggacgctgatgccaaagtgatagacgagagccctcac
cttctcgaaaaccagaatatcatgtccggcgacgcattcatcgtagagttcaagcagccc
gatgggtggcttatagacacccaagccgcagcgaaaaaacctgtggccgctatagaaccg
cccccaccattattcgattcgaagaatagcttttttaatcgccttgggacatcctcatcc
acagtcgccactaccaaggccagcacagaactttctacggcattcacaaagccgaccatc
tcgattaataaatcaagtttcacgaagacgctggagccaggaacgctggggcttggtaac
atgggaaatacgtgttttatgaactctgccttgcaatgcctggcccacacgaaagagctg
accgagtatttcctgaacggggtcttcaaagccgaactcaaccgcgacaatccattaggt
atgcagggccaaatcgctgaagttttcggcgccctgcttgagcgcatctgggcgtcttcc
ggtccatcaacgagctattcccctcgagaattcaagcaaacccttcaaagattcgcccct
cagttcagtggctaccagcagcacgattcccaggaactcgtcgcctttttacttgatgga
ctgcacgaagatttgaaccgcgtcatcaagaagccttacgttgagaaacccgactgggag
ggaggcggagatgcagaactggtgaaactagcggccaagtcctgggagggatacatgctt
cgaaatgatagcgtcatcgtcgacctcttccaaggccagtatcaaagtacccttgtgtgc
cctgaatgcgagaagatttccatcaccttcgacccattcatgtacctaacacttccactg
cctgtgcaaaagaagtggaagcacaccatcttctatgtcccctgggacttagaaaaaccc
catgtcaaggtgcccattgaaatcaaccgcgattcttctttcagagaccttcggaatgtc
cttgggcgctgggtcggggcaattccagagaatctcctcatgctcgaaattttccagcac
aagttctataagctgcttgacgacagtcttcccgtgaatgaaatgtcggagactgacgtc
attgtgtgctttgaactcccctgcaatgcccgaatgaaccgaacctacaagaagaaggaa
gacgatcctttcatcctcccacttttcctttgcgatgcaaagcccacagcgacccgcggc
ttcacataccgctcgggcccttccttgtttggttacccagctattgttgtcgtcgacaga
ggccaagccacaaccgtcgacgcaatttacgatgcggttattacccgccttcagcgctgg
accaagaatgcacgggacttgtacgattgggaggtatcgtccgaacccatcagtgaagtc
tctatcccagtccctggcttcccacctctggagacggttacagaaattacccctactgcc
gagggcgaggtcgtcgtccaaccctccgccgaggaaagcgttatcgtggacgaaaagaat
atggttgtcgacgaagaagccccgtcggacgacgtcgaactcgaagttggcacacccagg
ccctaccgtaccaagaaggacgtcttcaccctcaagatttacacgaatcaaaaggagtat
ggggccggctatggcacgtactccagaacagaagaatgggcgacatgggagcatcgcttg
gcagaccaagagacagggatcgatcctttcctgatccgccaagacgacgctttgtacgcc
gagttcgacgagaacatgaaggcctactatttcggagattcgaagcttgagaatgctcga
tgggacgagcgtgagtgggaagagttcgttcatccagagttggcggcgaaccagaaggcc
gattcattgaaacaaagaagggggatcactctgcaagactgtttggaggagtttgttaag
gaggaacagttgggcgaggatgatctgtggtattgcccatcgtgcaagaagcatcaacag
gcgaccaagaaattcgatttgtggaaagcgccggacatcctggtcgtacatctcaagcgc
ttcagcaataaccggattctccgcgataagatcgatacctttgtcgactttccagttgaa
gggctggatttgggtgataaggttggggaacgggcagtggctacgaggttgaaggagcaa
ggggtggagctggaagagttgaagacagtgaatctcgacgagcccctcgtttatgatttg
ttcgccgtggatgaacacatgggcggacttggtggtggacattaccgtgcctatgcttcc
aaccacctgacgggcaagtggtaccactttgacgacggatatgtgaaacaagcgtcagcg
gaggagtctgtgaattccaatgcttatctcctcttttatcgacgtcgctccagcaagccc
ttggggggtgaaacctaccagcgggccatgcagaagaaaccacaggtcgaaccctcgctt
gacgactcggagtcgaccgaaatcaatctggacgactctgggttaccgactcctccaagt
gaaggagatgccacttttattgggccctcggacaggttctcaccttcttcttccacgctc
ccatttgctgactattggaaccgttcgaatcccacatcctctggaccatcccctcccaat
gacgacccacccacctttgaagacgcgcaatctgatccattggtcattccggacgttcat
gaatcgttcgcatacgatagtggaatctacatgtcctcataccgcagaacgtcgccaaca
tcctctaacgaagctgaagctgacggggcggaatcgttttgggacgaactcgtcgacagt
ggcaggaattcaccgagctgggagaaggggagcaggtttgcgtcgccctcgcattctgag
tcgcagtcgtcggatttgaatttgaatccgtttgacgaccagaatgtgcagcggatcgag
ctggacgatgatgttaaggatgaagctgatgtgactaaacgagcctga

DBGET integrated database retrieval system