KEGG   Coprinopsis cinerea: CC1G_00894Help
Entry
CC1G_00894        CDS       T01275                                 

Definition
atypical/PIKK/FRAP protein kinase
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
cci  Coprinopsis cinerea
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 2380 aa AA seqDB search
MASADQAPVGDQQLNAIFSGLKSRSADTRMQAAEDLKRFVQVSYAEMTSDAAAKLWDDHI
NRRLFALIHSQNINEAFGGLLGIERLLELDLEETIESKRNHFRFYNYVKHLLPNPDVHLM
MAASKTLGKIAEIGGGVAFGERFMEYEIPAAIELMQPDKQEAPRYAGVLILKELARNSPT
YFHPHIGIVFDNILLPLRDPRLHVREGAADLLANCLEIVCSRERQTRNPYLYKILQDAQA
GLKSSQPEVIHGSLAAYRELLLHAGMFMQENFLDTAEAILRFKSSRDPLVRRMVITMIPT
LAAYDTQTFTEHFLHKAMAHLLTQLDKAPERNFAFIAIGHTALAVGSDMKPFLDPIMDNV
RSCLQNRGRKNAPSEEPIFQCIGMLAAAVGPNLTKLLHDQLDLMLACGLSEPLSQALAAI
AKYIPPLLKTIQDRLLQLLSMLLSGQPYRPLGAPAPLGRNEFPAPPNQLTATQMTTTDKN
SELITLALKTLGTFDFSGHVLNEFVRSCALPYLEDDNPQVRCAAAETCCTLFIKDPICYQ
ASSHAIEVISDVLDKLLTVGIADPDPGIRNVVLRGLHERFDKHLAQAENVRSLFIALNDE
VMANREAAVGLIGRLAKHNPAYVMPSLRKALIQLLTELEYSTVMRNREDCTRLLTLLVSA
TQRLIKPYAIPMLRVLLQKANDPNPAVAANVLMCLGELACVAGEDAMPHVQELMQIILAK
LADPQTLKRDAALHALGQVCSSTGYVVQPLLDHPQLLPLLGRIMRTETSVQTRREVVKVL
GILGALDPYRRKSRPDEDVASNAETSVAAVNQVPINPHPTSSSSDDYFQTVVITSLLAIL
KDQSLSSHHHTVIEAIMSIFKTQGLKCVTFLPQIIPAFAAITRTSIARLQEFHLQQLAIL
VGIIKQHIRNYTLDVFSLITELWDNVTLQLPIVALIEALGKALDAEFKPFLPTILPLVLK
VFDGDTSDKRIAVQIKIFDAFLTFGANIEEYLHLVIPIIVKSYERSDAPSSLRKRAIQTI
DGLSRRVNFSDHASRIIHPMVRVLDGNNNELRMAVFDTLCSLVAQLGSDFAIFVPTINKA
TLRNRISHPRYENLVSKLLNGESLPSEAGGMDWIQAENSKAQEFQAPAEAPKMTVNQQHL
KQAWDVSQVTTKDDWLEWMHRLSVEFMKESPSHALRACMTLVDIHQPLAKELFNAAFLSC
WTELYDQYQEDLVRSIEFAITSTTAPPELIHRLLNLAEFMEHEEKPLPIEHRTLGEYANK
YMAYAKALHYKEMEYFAESSPAVIESLISINTKLQQHDAAWGTLLHAREQYDVTKHEEWY
ERLGRWQEALQVYDRKAMEDPDSPEVKIGRVKCYHALGEWELLAAQVQENWANATNEERR
EMAPMAAAAAWSLNDWDSMDNYIGTMKNDSPDRAFYRAILSVHQNQFSKALAHIAKAREL
IDPELSSFTGEGYGRSYNVMVRAQMLSELEEIIAYKQYADQPERQATMRKTLQGCQPDVE
VWQRILQVRTLVSSPEQDPVMWIKFANLCRKNDRMMLAEKTINSLLTPERRMLDHHHHHN
TKAPPNVVYAQLKYMWANGEKEETLNHLRLFTASLAKDIQQETNEQGHRPNVSKSKLAEL
TKLLARCYFKQGEWQMELKDDWDARNVEDILHSYYYATHYDPGWYKAWHTWALANFEVIS
HIDTLAENRATDIPGDSLASHVVQAVTGKPPFVAVLDAMLILGKGFFRSISLRNQDALQD
TLRLLTLWFKYGHHDEVSHSMANGFSTVEVDTWLEVIPQIIARIQTPHANIRRNINNLLT
DVGKHHPQALIYPLTVASKSSSSARRTAAIQIMERMKDHSSTIVTQALLVSKELIRVAIL
WHEMWHEGLEEASRLYFNDKNPEGMIMALEPLHKLLEKGPTTARETSFAQVFGRELAEAR
EACKRYQIYGDPTELDKAWDIYYGVFKKVEKQLPSLTTLDLQYVSPSLLKARHLDLAVPG
TYQSGRPVITIASFATKLTVIASKQRPRRLSLKGSDGRDYQYVLKGHEDLRQDERVMQLF
SLVNTLLSVDTNSFKRRLHIQRYPVIPLAPNAGLLGWVQDSDTLHVLIRDYRESRKVLLN
IEYRLMLQMAPDYENLMLLQKVEVFEYALENTTGQDLYRVLWLKSTNSEHWLERRATYTR
SLAVNSMVGHILGLGDRHPSNLLLERSTGKVVHIDFGDCFEVAMHREKFPEKVPFRLTRM
LTHAMEVSGIEGSFRNTCEITMTVLRDNKESLMAVLEAFVYDPLINWRLMQADVEVRRPD
ADVERVPELGRVAAHPQAPNRKLKADENDIFNETEEEPGAQEVRNERALFVYNRVQHKLT
GRDFNPTQVLSVKAQVEKLIEQATSLENLCQCFSGWCAFW
NT seq 7143 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgcagaccaagccccggtgggcgaccagcagctcaacgccatcttttctggg
ctcaagtctcgtagcgcagacactcgtatgcaggctgcggaggatctcaagcgattcgtt
caagtatcgtatgccgaaatgacctcagacgcagctgcaaagctatgggacgaccacatc
aacagacgactattcgccttgattcacagccagaacattaacgaagcatttggtggactg
ttgggaatagaacgcctcttagaactcgacctcgaggaaaccatcgaatcgaagcgcaac
cacttccgattctacaactatgtgaagcacctcctccccaaccccgacgtgcacttgatg
atggcggcttcgaagacattgggaaagattgcagagattggcggcggtgtggcctttggc
gagaggtttatggaatacgaaatcccagcggctatcgagttgatgcaacccgacaaacaa
gaagccccacgatatgcgggtgtcctgatcttgaaggaactggccaggaatagcccaacg
tatttccatccgcatattgggattgtgttcgacaacatattgctgccactccgagacccg
cgactgcatgtgcgagagggtgccgccgacctgctcgctaattgcttggagattgtgtgt
agtcgggagaggcaaacaaggaacccgtacctttacaagatcttgcaagacgctcaggcg
ggcctcaagagttcgcagccggaggttatccacgggtcgttggctgcgtaccgggagttg
ttgcttcacgctgggatgttcatgcaagagaactttttggatacagcagaagccatcctt
cgcttcaaatcatctcgagatcctctggtccgtaggatggttattaccatgatcccgact
ctggcagcgtacgacacccaaaccttcaccgagcactttttgcacaaggccatggcccat
cttcttacacagctcgacaaagcacctgagcggaacttcgcttttatcgccatcggccat
actgcacttgctgtgggcagtgatatgaaaccatttttggatcccatcatggacaatgtg
aggtcgtgcctacagaatagagggcgaaagaatgcgccctcggaagagccaatattccag
tgcattgggatgttggcagccgccgtcggtcccaaccttacaaagttactgcatgaccag
ctagacttgatgcttgcatgtggtttgagcgaaccattgagccaagctctggcagccatc
gccaagtacatccctcccctgctcaagacaatccaagatcgcctcctccaactcttgtcc
atgcttctgagtgggcaaccctatcgaccgctcggtgcaccggcgcctttaggtcgtaac
gaattccccgctccgcccaaccaactgacagccactcaaatgacgacgaccgacaagaac
tccgaactcatcactctggctttaaagaccctcggaacgtttgactttagcggtcacgtt
cttaacgagttcgttcgcagctgcgcgttgccttatttagaagacgacaaccctcaagtt
cgctgtgcggcggcagagacctgctgtaccttgttcatcaaggatcccatttgttaccaa
gcgagtagccatgctatcgaggtcatcagcgatgttctggataagttgctcactgttggc
atcgctgatccggatcctggcatccgtaatgtcgtcttgcgagggctccacgaacggttc
gacaagcatctcgctcaagctgaaaacgttcgatccctgttcattgcactgaatgacgag
gtcatggccaaccgagaagcagccgttggcctcatcgggcgacttgccaaacacaaccct
gcatacgttatgccttccctccgtaaagccctcattcaacttctaaccgagttggagtac
tcgaccgtgatgcgcaatcgagaggattgcactcggctcttgactctgctggtcagtgcg
acccagcgactcattaaaccttacgccattcctatgttgcgcgtgctccttcagaaggcg
aacgaccccaatcccgccgtggcggcaaacgttctcatgtgtctcggagagctggcttgt
gttgcgggcgaggatgctatgccccacgtccaagagctcatgcagatcatccttgccaaa
ctggccgacccccaaacgttgaaacgtgatgctgcacttcatgcgttaggtcaggtctgc
tccagcacgggctatgtcgtccagcctctgcttgaccatcctcaacttcttccgctgctc
ggaagaatcatgcgaacagagacctcggttcaaactcggcgagaagttgtgaaggtcttg
ggcattctcggtgcccttgatccctaccgacgaaagtcgaggccggatgaggatgttgca
tcgaatgcggagacttcggttgctgcagtaaatcaagtccccattaatccacaccctacg
tcgtcatcatcggacgattacttccagactgtggttatcacgtccttgctcgcaattctg
aaggatcagtctctcagcagccaccaccataccgtaatcgaagccatcatgtcgatcttc
aagacccaaggattgaaatgcgtgaccttccttccccaaattattcccgccttcgctgct
attactcggacatccatcgcccgactccaagaattccatctgcaacagttggccattctc
gtcggcatcatcaaacagcacattcgcaactatactctggacgtgtttagcttgatcact
gaactttgggacaacgttaccctgcagctgccaatcgttgcgctcattgaggctctagga
aaggcgctggatgctgaattcaagcccttccttccgactatcctacctctcgtcctcaag
gtattcgacggggacacgagcgataaacggattgcggttcagatcaagatcttcgacgca
ttcctgacctttggagctaacatcgaagagtacctgcacctcgttatcccgattattgtc
aagtcctatgagcggtcagacgcgccatcttctctgcgaaaacgcgccatacagaccatt
gacggtttgtctcggagggtcaatttctctgaccacgcctctcgcatcattcaccccatg
gttcgcgttctggatggcaataacaatgagttgcgcatggctgtcttcgacacattgtgc
tccctcgttgcacagcttggctccgattttgctatctttgtgcccactatcaacaaggca
actttgcgcaaccgcatctcccatccgcgatacgagaacttggtttccaagctcttgaac
ggagaaagtctcccttccgaagctggcggcatggattggattcaagccgaaaattccaag
gcccaagaattccaagctccggcagaggcgcccaagatgactgttaaccagcagcacctc
aagcaggcatgggacgtgtctcaggttaccaccaaagacgattggcttgagtggatgcac
cgcctgagtgtggagtttatgaaggaatcgccttcgcatgctctgagggcttgtatgacg
cttgtcgatatacaccaacctctcgcaaaggagctgttcaacgctgccttcctctcttgc
tggacagagctctacgaccaataccaggaggatttggttcgatccatcgagttcgccatc
acatcgactacagcacctcccgaactgattcaccgcctcttgaacttggcagagttcatg
gaacacgaagagaaaccccttcccattgagcatcgcactctgggagagtacgccaacaag
tatatggcctacgcaaaggccttgcactacaaggagatggagtattttgccgagtcgtca
cccgccgttatcgagtccctcatctcaatcaacaccaagctgcagcaacatgatgcagct
tggggaaccctactccacgctcgggagcagtacgatgtcaccaagcatgaagagtggtat
gaaagattggggcggtggcaagaggcactgcaggtctacgatcggaaggcgatggaggac
ccagactcacccgaggtgaagattggtcgagtaaagtgttatcacgctttgggtgaatgg
gaattgcttgctgcccaagtccaggagaactgggccaacgcaaccaacgaggaacgacgt
gagatggcacccatggccgcggctgctgcgtggtccctgaatgactgggactcgatggac
aactacatcggtaccatgaaaaatgactcgccggatcgcgcgttctacagggctatcctt
tctgtccaccagaaccagttctccaaggcacttgctcatattgctaaggcgagagagctg
atcgaccccgaattgagttccttcacaggagaggggtacggcagatcatacaatgtcatg
gttcgggcccagatgctttccgagcttgaagaaatcattgcctacaaacaatacgcagat
cagcccgaaaggcaggcgacgatgagaaagacgttgcaaggatgtcagccagatgtcgag
gtctggcaacgtatcctccaagtccgcacattagtctctagccccgagcaagatcctgtt
atgtggatcaaattcgccaacctttgccgcaagaacgatcggatgatgctcgctgagaag
actatcaactccctgctgactcctgaaaggagaatgctcgatcaccaccatcaccataat
accaaagcaccccccaacgtcgtctatgctcaactgaagtacatgtgggccaatggtgaa
aaagaagagaccttgaaccacctcaggctattcaccgccagcctggccaaggacatccag
caagaaacgaacgagcagggacatagaccaaacgtgtcgaagtcaaagttggcagaactc
acaaaactgttggccaggtgctacttcaagcaaggagagtggcagatggaattaaaggat
gactgggacgcgaggaacgtcgaggatatcctccattcgtactactatgctactcattat
gaccccgggtggtacaaagcatggcatacgtgggctttggccaactttgaggtcattagc
cacatcgacacattggcagagaatcgggctacagacatccctggagattcgctggcatcc
catgtcgtgcaagcagtaacaggtaaacctcccttcgtagccgtccttgacgccatgttg
atattaggcaaaggtttcttccgatcaatatctctccgcaaccaggatgccctgcaggac
actttgcgattactgaccctctggttcaaatacggtcaccacgacgaagtcagtcattcc
atggcaaacggcttttcgacagttgaagtcgacacctggctggaagtcattcctcagatt
attgcccgcattcaaacgccacatgctaacattcgccgaaacatcaacaacctgttgact
gacgtcggcaagcatcatcctcaggccttgatttatccattgaccgtggcttctaaatcc
tcgagttcggcacgtcgaactgctgccattcaaatcatggagcggatgaaagaccacagc
tcgacaattgttactcaggccctccttgtcagcaaggaactgatccgtgttgcaatcctc
tggcacgaaatgtggcatgaaggcttggaagaggcttctcgcctgtacttcaacgacaaa
aatcctgagggtatgatcatggctcttgagccgttgcacaagttgttggagaagggacca
acgactgcgcgtgaaacctcatttgcacaagtcttcgggcgagaacttgcagaggcccgt
gaagcctgcaagagataccagatctacggtgatcctacggagctcgacaaagcctgggat
atctattacggcgtcttcaaaaaggtcgagaagcaactcccatcactgacaacccttgat
ctgcaatatgtgtcgccaagtctgctcaaggctaggcacttggacctcgcggtacccggc
acatatcaaagcggtcgtccagtcattacaattgccagcttcgccacaaaattgacagtc
attgcatccaaacaacggcccaggcgactgtcattgaaggggagcgacggacgagactac
caatacgtgttgaaaggacatgaggaccttcgtcaagatgaacgtgtgatgcagcttttc
agcctggtcaacaccctactctccgtcgataccaacagtttcaaacgccgccttcatatc
caacgatatcctgtcatcccgctggcaccgaacgccggtttgttgggttgggtccaagac
agtgacactctccacgttctcatccgtgattaccgcgagtcaagaaaggttctcctgaac
atcgagtatcgcctgatgctccaaatggctcctgattacgagaacttgatgctcctccag
aaggttgaggtctttgaatacgctctggaaaacaccacgggtcaggatctctatcgagtg
ctgtggctgaagagcaccaactcggaacactggctcgagaggcgtgccacctatacccga
tcgctcgccgtcaatagtatggtcggccatatcctgggactcggtgaccgccacccgtcc
aatctgcttctggaacgcagcacagggaaagtcgttcacattgatttcggtgactgtttc
gaagtcgccatgcatcgagagaaattcccggaaaaggttccattccgcctaacgaggatg
ctgacacacgcgatggaagtcagtggaattgaaggaagcttcaggaatacatgcgagatt
acaatgactgtcctgagggataacaaggagtcgttgatggccgtccttgaagcgttcgtt
tacgacccgttgatcaactggaggttgatgcaggccgacgtggaagttagacggccagat
gcggatgttgaacgcgtccctgaacttggccgagtagctgcgcatccccaagctcctaac
aggaagcttaaggccgatgaaaacgacatcttcaatgaaacggaggaagagccgggagca
caggaggttcgaaacgagcgagcactattcgtgtacaatcgcgttcagcacaagctcacg
ggccgagactttaaccccacccaggtcctcagtgtcaaggcccaggtggagaagctcatt
gagcaagcaacttctttggaaaatctgtgccagtgtttctctggttggtgtgccttctgg
taa

DBGET integrated database retrieval system