KEGG   Coprinopsis cinerea: CC1G_01073Help
Entry
CC1G_01073        CDS       T01275                                 

Definition
(RefSeq) histone acetyltransferase
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
cci  Coprinopsis cinerea
Brite
Enzymes [BR:cci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CC1G_01073
Transfer RNA biogenesis [BR:cci03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CC1G_01073
Chromosome [BR:cci03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    CC1G_01073
   HAT complexes
    Elongator complex
     CC1G_01073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47
Motif
Other DBs
NCBI-GeneID: 6009502
NCBI-ProteinID: XP_001833011
UniProt: A8NEF4
Position
2
AA seq 554 aa AA seqDB search
MVQGSKVDGPSQAETLLRVTSGIAAELIKAHDAGESVSLNILRAKISKKFGYGGVPRLVD
IISAIPDDYKKALLPKLKARPIRTASGIAVVAVMCKPHRCPHIAMTGNICVYCPGGPDSD
FDYSTQSYTGYEPTSMRAIRARYDPYEQTRGRVEQLKSLGHSVDKVEFIVMGGTFMSMPE
DYREKFIAQLHNALSGYTGTNVDEAVRFSEQSKSKAIGITIETRPDYCLRPHLSQMLRYG
CTRLEIGVQSVYEDVARDTNRGHTVRAVSECFHLAKDAGFKVVAHMMPDLPNVGIERDLE
QFKEYFENPAFRSDGLKLYPTLVIRGTGLYELWRTGRYKNYTPNVLVDVVARILALVPPW
TRVYRVQRDIPLPLVTSGCDNSGNLRELALNRMKDFGAVCRDVRFREVGIHEIHHKVRPE
SVELLRRDYTANGGWETFLSYEDPEKDILIGLLRLRKCSDEGTFRPELVKTEQGSCSIVR
ELHVYGTAVPVHGRDPTKFQHQGFGTLLMEEAERIAREEHGSIKLAVISGVGTRDYYRKL
GYELDGPYMSKMLI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggttcagggatccaaagtagacggcccttcccaagccgaaaccctcctccgcgtaacc
tcaggaatcgccgcagaactcatcaaagcccacgacgccggcgagtccgtctccctcaac
atcctccgcgccaaaatcagcaaaaagttcggatacggaggtgtaccccgtctcgttgac
atcatcagtgctatcccagatgactacaagaaagcgctgttgcctaaactgaaggcgagg
cctatcaggactgccagtggaattgcggttgtagctgtgatgtgcaaaccccatcggtgt
ccgcatattgcaatgacggggaatatctgtgtatattgtcctggaggacccgattcagac
ttcgattacagtacacaaagttataccgggtacgaaccaacgagcatgcgagctattcgt
gctcgatacgatccttatgagcaaacgcgagggcgagtggagcagttgaagagcctggga
cacagtgtcgataaggtcgagttcattgtcatgggaggcacctttatgagtatgccagaa
gactaccgtgaaaagttcattgcccaattgcacaatgcattgtccgggtataccggaact
aatgtcgatgaagctgtcaggttttcagagcaaagtaaatcaaaagctatcggtattaca
atcgaaacccgccccgattactgtctacggccccatctcagccagatgctccgctacggc
tgcacccgtctcgaaataggcgtccaatccgtctacgaagacgtggcccgcgacaccaac
cggggccacaccgtccgcgccgtctccgaatgcttccacctcgccaaagacgctggtttc
aaagtcgtcgcccacatgatgcctgacctccccaacgttggtatcgagcgcgatcttgaa
cagttcaaagagtattttgagaatccagcgtttagaagcgatggattgaagctttatccg
acgttggttattagaggaacggggttgtacgagttgtggaggacggggagatataagaac
tatacgccaaatgttctggtggatgtggtggcgaggattttggcgttggtgcccccgtgg
actagggtttatcgtgtgcagagagatatcccattgccattggtaacaagtggatgcgac
aactctggaaacttgcgtgaactcgctcttaaccgaatgaaagactttggagccgtgtgt
cgagacgtacggttccgcgaagtcggtatccacgaaatccaccacaaagtccgaccagaa
tccgtggaactcctccgacgagactacacggccaatgggggttgggagactttcctgtcc
tatgaagatcccgagaaggatatcttgatcggcttgctgcggttgcgaaagtgctcggat
gagggtacgtttaggccggagttggtgaagaccgagcagggtagctgcagtattgtgcgg
gagttgcatgtgtacggaactgctgttcctgtacatggaagggacccaacgaaattccag
catcagggctttggaacgctgttgatggaagaggctgagcggatagcgagggaggaacac
ggaagcatcaagctggctgttatctctggtgtcggaacgagagattattacaggaagctt
gggtatgagctcgacggaccctacatgagcaagatgctcatctag

DBGET integrated database retrieval system