KEGG   Coprinopsis cinerea: CC1G_01098Help
Entry
CC1G_01098        CDS       T01275                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
cci  Coprinopsis cinerea
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CC1G_01098
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CC1G_01098
Enzymes [BR:cci01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CC1G_01098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 312 aa AA seqDB search
MATALRFVPEPKTIAIVGCPFSGGQPKPGVDKGPIHLVEAGLITQLEGLGWKVKFNGHHQ
FEDISAENDPPIGILKNPRLVSRVTKSVADVVGSHVKNGELPVTLGGDHSLAMGTIFGTL
SHHPNACVVWVDAHADINTVESTDTGNIHGMPLSFLLGLGSKVPEFSWVKPLLKNDSLVY
IGLRDVDPGEKAILRENNIKAFSMHEVDKYGIGKVVEMALNHVNPNRDRPIHLSFDVDAL
DPSVAPSTGTPVRGGLTFREGHYICEAIYETGLLVAMDLMEVNPSLADAASVEQTVTVGC
SLLRSALGETLL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccttgcgtttcgtccccgaacccaagactattgctattgtaggatgtcca
ttcagcggcggacagccgaaacctggtgttgacaagggccccattcacctcgtcgaagca
ggccttatcacccaactcgaaggactagggtggaaggtcaaattcaacggacaccatcag
tttgaagatattagcgcggagaacgaccctcccatcggtatcctcaagaacccccgtcta
gtctctcgcgtgacgaagtctgtcgccgatgtggttggtagccacgttaagaacggcgag
ctgccagtcacgctgggaggagaccattcactggcaatgggcacgattttcgggacgttg
agtcaccatcctaatgcttgcgtagtctgggtggatgcgcatgccgatatcaatacggta
gaatcaacggataccgggaacatccacggaatgccgttgtctttcctcctcggtcttgga
agcaaggtccccgaattctcttgggtgaagcctttgttgaagaatgattccctggtttac
attggccttcgggatgttgaccccggagagaaagccatcctgcgtgaaaataacatcaag
gctttcagcatgcacgaagtcgataaatacggcattgggaaagttgtggagatggcattg
aatcatgtcaaccctaacagagaccgtcctattcacttgagcttcgatgtagatgcgctc
gacccttctgttgccccgtcaaccggaacaccagtccgtgggggtctcaccttccgagaa
ggtcactacatctgtgaagcaatctacgagaccggcctattggtagcgatggatctcatg
gaagtcaacccctcgctggcggacgctgcgagtgtcgagcaaacggtgactgtcgggtgt
tctttgcttcgctctgccctaggtgaaacgcttctctga

DBGET integrated database retrieval system