KEGG   Coprinopsis cinerea: CC1G_01111Help
Entry
CC1G_01111        CDS       T01275                                 

Definition
3-hydroxyisobutyryl-Coenzyme A hydrolase isoform 1
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
cci  Coprinopsis cinerea
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CC1G_01111
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CC1G_01111
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CC1G_01111
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CC1G_01111
Enzymes [BR:cci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     CC1G_01111
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 488 aa AA seqDB search
MLRLLGRRMSPTAARLAAQRTRAIGQHMMSTTPESTVLFESNKSIRKFILNRPNKLNALD
TPMLELLRPKILEWNSSDLCGAIVGTGAGRAFCAGGDVATVVENASDPTTRPLAIDFFKK
EFEVDYILASLKKPYVAILDGITMGGGVGLTANALFRVATEKTLWAMPETKIGYSPDVGG
SYFLSRLDGEIGTYLGLTGESLSGRAVFEHGLATHFLPSRRIPLLLERLSELDDPSAALI
DKTIEEMSCEREPNEPRSLLTGGVRAALDAAFRHNEVEQIFASLEELSQVEDASIKQWAQ
ETLQKLNQRSPTSLKVALAAIRRGKKLDLAQAMAMELRIAGAFCNGASPDFKTGVETVIK
TKSKDVPAWSPSKLEDVAPEAVSRFFDSTSSFIQGLPALEIPQGLEAIPDNRHLKYALPT
EAEIGAVVKGSHPGAGDMGWTAEEVQTFFSKQYPGKHGVREKVEEVLQRRCTIIDNVDGN
FVWLKWNA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggctacttggaaggagaatgtcgccgacagctgccaggttagctgcacaacgt
accagagctattggccagcacatgatgtccacaaccccggagtctacagtgctctttgag
tctaacaaatccattcgaaagttcatcttgaaccgaccaaacaagttgaacgcccttgac
acacccatgcttgagctgctcagacctaaaatcctggaatggaactcttccgacctttgc
ggtgccattgtcggtacaggcgcggggcgcgcattctgcgcaggaggcgatgttgccacc
gtggtagagaatgcgtctgacccaaccacacgaccgttggcaattgacttcttcaagaaa
gaattcgaagtcgactacatacttgcatcactgaagaagccttatgttgctatccttgac
ggaatcacgatgggtggtggagttggactcaccgcaaacgcactcttcagagttgctacc
gagaagactctgtgggccatgccggaaaccaaaattggttattctccggatgttggcgga
agttactttttgtcgaggttggatggagagatcggaacatacctgggattgactggagag
tctctcagtggaagagctgtatttgaacacggcttagccacgcatttcctgccgtcaagg
cgcattcctttgttgttggaacgtctgtcggagttggacgatccatcagctgctctcatc
gacaaaaccatcgaagagatgtcatgtgagcgcgagccaaacgagcctcgttctcttttg
actggcggagtaagagctgctctagatgccgcattccgacacaacgaagtcgagcagata
tttgctagtctggaagaactttcccaagttgaggatgcttcgatcaaacaatgggcacag
gaaaccttgcagaaactgaaccagcgaagcccgacaagtctgaaggtcgccctggctgcc
atcaggcgagggaaaaagttggaccttgcacaagctatggccatggaacttcgaattgca
ggtgctttctgtaacggtgccagccctgatttcaagaccggcgtcgagactgttatcaaa
accaagagcaaagatgtacccgcatggtctccttcaaaattagaagatgtggcacccgaa
gcagtttcacgattcttcgactcaacgtcatcctttatccaagggctccccgcacttgag
atcccccaaggactcgaggcgatcccggataatcgacacctcaagtacgcgctaccgact
gaagccgaaatcggagccgttgtaaaaggttcgcatcctggcgcaggtgacatgggctgg
actgccgaagaagtgcaaaccttctttagcaagcaatacccagggaaacacggagtgcga
gagaaggtcgaggaagtcctgcaacgacgatgcacaatcattgataacgtagacggtaac
tttgtatggctcaagtggaacgcgtag

DBGET integrated database retrieval system