KEGG   Coprinopsis cinerea: CC1G_01359Help
Entry
CC1G_01359        CDS       T01275                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cci  Coprinopsis cinerea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CC1G_01359
Enzymes [BR:cci01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CC1G_01359
Exosome [BR:cci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CC1G_01359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 682 aa AA seqDB search
MPTPPLDPNVVLAIDGYLKPHIPAIIQRYNSYRRWKDTIDQHEGGYEKFTRGYERYGFNV
GPNSEVVYREWAPNATEAYLIGDFNEWNRQSHPMTKNEFGVWEITVPPLPGGRCAIPHDT
KVKISMILPSGERIERLPAWIKRVTQDLSVSPVYDARFWNPPASERYQFKNPRPPKVDNI
RIYEAHVGISTPEPRVGQYKEFTQNVLPRIKDLGYNAIQLMAIMEHAYYASFGYQITSFF
AASSRYGSPEDLKELIDVAHGMGITVLLDIVHSHACKNVLDGLNEFDGTDHLYFHEGGKG
RHDLWDSRLFNYGNHEVLRFLLSNLRYWMEEFRFDGFRFDGVTSMMYKHHGIGTGFSGGY
HEYFGDGVDEEGVVYLMLANDAIHTMYPDSITIAEDVSGMPLLGLPVQKGGVGFDYRLSM
AIPDMWIKLLKHKQDDEWDIGNIVFTLTNRRHGEKSIAYAESHDQALVGDKTLAFWLMDK
EMYTNMSDLTPLTPIISRGIALHKLIRLVTHSLGGEGYLNFEGNEFGHPEWLDFPREGNG
NSFQYARRQWNVLDDHLLRYKYLNNFDREMNTLAGKYKWLDSPQAYVSLKNEVDKVLVYE
RAGLLFVFNFHPTKSFTDYRVGIEVAGEYRIVLSSDEKRFGGFDNIDLKSQFFTTHLEWN
GRKNFLQVYIPTRTAIVLAKVN
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgcctacaccacccctcgatcccaacgtcgttctcgctatcgacggttatctcaaaccg
cacatcccagctatcatccagcgatacaactcgtaccgacgatggaaggacaccattgac
cagcatgaaggcggatacgaaaagttcaccaggggatacgagcgatacggcttcaacgtc
ggtccaaacagcgaggttgtttatcgagaatgggcccctaacgcgacagaggcttacttg
attggagacttcaatgaatggaatcggcaatcccacccgatgaccaagaacgagtttggc
gtctgggagataacggtcccgccgctgccaggcgggagatgcgccatccctcatgacacc
aaagtcaagatttctatgatccttccatcgggcgaacggattgagagattacctgcttgg
attaagcgcgtcacgcaggacctgtctgtgtcccctgtgtacgacgcacgtttctggaac
cctccggcttcagagaggtaccagttcaaaaacccacgacctcccaaggtggacaacatt
agaatctatgaggcccatgttggtatctccaccccggagcctagggtcggtcagtacaag
gaattcacccagaatgtccttccaaggatcaaggacctcggttacaacgcgattcaactc
atggctatcatggagcatgcgtattacgcttcatttgggtaccagatcaccagcttcttt
gctgcgagttcgcgttatggttcccccgaagacctgaaggaactcatcgatgtcgctcac
ggcatgggtatcactgttcttctcgatatcgtccactcgcacgcttgcaagaacgtcttg
gatggccttaatgaatttgacggaactgaccacctctacttccacgagggcggtaaaggc
cgtcacgacctctgggatagccgtctcttcaattacggcaaccatgaagttctccgcttc
ctgctgagcaatcttcgctattggatggaagaattccgcttcgatggattcaggtttgac
ggtgtgaccagcatgatgtacaagcaccatggtatcgggactggcttttcgggagggtat
cacgagtacttcggagacggggtggacgaggaaggcgtcgtttacctcatgcttgcaaac
gacgcgattcacaccatgtatcccgactctatcaccatcgcagaggacgtctctggaatg
cctctgcttgggctcccggtccagaagggcggtgtcggtttcgactaccgcttgtccatg
gccattccggacatgtggatcaagttgctaaagcacaagcaggacgatgaatgggatatt
gggaacatcgttttcactctcacgaacaggcgccacggtgagaagagcattgcctatgcc
gagagtcacgatcaggctctcgtcggggacaagactcttgccttctggctcatggataag
gagatgtacaccaacatgtccgatctaacacctcttacacccatcatttctcgcggtatc
gcccttcataagctcattcgacttgtcacgcattcccttggcggagaaggatacctcaac
tttgaaggcaacgaatttggtcacccggagtggttggacttccctcgagaaggaaatggc
aattccttccagtacgcccgtcgacaatggaatgtcctggacgatcaccttctgcgctac
aagtatctcaacaacttcgaccgcgaaatgaacactttggccgggaagtataaatggcta
gactctccccaggcatacgtttctctcaagaatgaagtcgacaaagttctcgtttatgag
cgcgcggggttgttattcgtcttcaacttccaccccacgaagagcttcaccgactatagg
gttggaatcgaagtcgccggagagtatagaatcgttttaagcagtgatgagaagcggttt
ggaggcttcgataacatcgatttgaagagccagttctttacgacacatttggagtggaat
ggtcgcaagaacttcttgcaggtctacatacccactcgaactgccatcgtcttggccaag
gtcaattaa

DBGET integrated database retrieval system