KEGG   Coprinopsis cinerea: CC1G_01960Help
Entry
CC1G_01960        CDS       T01275                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cci  Coprinopsis cinerea
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CC1G_01960
Enzymes [BR:cci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CC1G_01960
Exosome [BR:cci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CC1G_01960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 331 aa AA seqDB search
MASLEISSVLQGGYQHPVARSWQGRRGLAKSMFMYPIFITDDPNASTVIPSLPNQRRWGL
NKLEEFLRPLVRKGLQSVILFGVPLNCTKDGRGTPADDEQGPVIQAIKLIRRCFPNLYIA
CDVCLCEYTDHGHCGLLNEDGSINTEPSVDRISDVAAAYARAGAHCVAPSDMMDGRIMAI
KRKLIDGGFGNKVTLMSYSAKFASSLYGPFRDAAGSAPSFGDRKCYQLPPAAKGLARRAI
LRDANEGADIIMVKPSLPYLDIIADAAELTPDHPIACYQVSGEFAMIHAGAAAGVYDLKT
MAYESAESMVRAGATLILSYFTPEFLDWLEV
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcttgaaatatcctctgtgttgcaaggcggataccaacaccccgtggctcgc
tcgtggcaaggtcgacgaggtctcgcaaagtccatgttcatgtacccaatcttcattacc
gacgacccgaatgcttctactgtgatcccttcacttcccaaccagcgccgctggggactc
aacaagcttgaagagtttctccggcctctcgtgaggaaaggtcttcagagtgtgattctc
ttcggtgtacctctcaactgcaccaaggacggccgaggcacaccagcagatgacgaacaa
ggccctgtaatccaagccatcaagctaatccgccgttgcttccccaacctctacatcgcc
tgcgatgtctgcctctgcgaatacaccgaccacggacactgtggtctcctcaatgaggat
ggatccatcaacaccgaaccctctgtcgacagaatcagcgacgttgcggccgcttatgcc
cgagctggtgctcactgcgtcgcgcctagtgatatgatggatggtcgaatcatggctatc
aagaggaaactcattgacggtggatttgggaacaaagtgacgctcatgagctattctgcc
aagtttgctagttcgctgtatggtcctttccgagatgctgcaggaagcgcgccttctttc
ggagaccgtaaatgctaccagttgcctcccgcagccaaaggacttgctcgtcgagctatc
cttcgagatgctaacgaaggagccgacatcattatggtcaagccctctcttccctacctg
gacatcatcgctgacgctgcagagctgacccccgatcatcctattgcttgctaccaagtc
agcggtgaattcgccatgatccacgcaggtgccgcagctggtgtatacgatttgaagacc
atggcttatgagagcgccgagagcatggtcagggcaggcgcgactcttatcttgagttat
tttaccccagagttcctcgactggctggaggtttag

DBGET integrated database retrieval system