KEGG   Coprinopsis cinerea: CC1G_01983Help
Entry
CC1G_01983        CDS       T01275                                 

Definition
STE/STE7 protein kinase
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
cci  Coprinopsis cinerea
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cci00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CC1G_01983
Enzymes [BR:cci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CC1G_01983
Protein kinases [BR:cci01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   CC1G_01983
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 470 aa AA seqDB search
MEAKTTTLPRPMGPRGPTPGRRPPFPTIRTTGNLPTSPIQPADPPMLAPPTLGIPQRGKK
PILGLKIDKNNTSFELYAGGPSGPPESYMSPGDDARTIRPGPATIQPGGDTGTTTVPASK
PGASEPITRIQDLLRDLNLTQPPPTVNPSPGDSILSKIEDPSSTQWSDECFEEISRLGEG
AGGAVHKVKDKRNGMIMARKTITTREAPMKQLLRELTIMSSTKHVNIITFYGAYMSPSSS
EIKIIMEYCEGGSLESVGKRIRERGAIVGEKIAGRLAEGVLQGLSYLHSKKTIHRDIKPS
NILLSKEGVVKLCDFGVSGELILSQAGTFTGTSFYMAPERIQGKEYTIRSDVWSTGISLL
ELVQNRFPFPPDLPPIELMMYITNSEPPRLEDEPGVNWSEEMKDFIKQALTVDPVDRPTP
KDMLEHPWIKNMMKYENTMGRWIAQVWGWSRSKKSRDESSSRPGTASGTP
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggaagccaaaacgactaccctgccacgtcccatgggtccaaggggcccgacaccgggt
cgtaggcctccctttccgacgatcaggacgacaggcaatctcccgacgtcgccaatacaa
ccagcggatcccccaatgctcgccccgcccactctaggaatcccacagcgaggaaagaag
ccgatattgggcctcaagatcgacaaaaacaacacttcattcgaactttacgctggaggg
cctagtggtcctcccgagtcgtatatgtctccgggcgatgatgcaagaacgatcagacct
gggcccgcgacaatccaaccaggcggtgacaccggcacaacgactgtccctgcatccaag
cctggtgcatctgaacctatcacccgaattcaagatctacttcgtgacttgaatttgacg
cagcccccacccacagttaatccgtcgccaggcgattctatcttgtccaagatcgaagac
ccgtcgtctacacagtggtcagatgagtgtttcgaggagatttccaggctcggtgaaggc
gctggaggagctgtccacaaggtcaaagataagcgcaatgggatgatcatggcgcggaag
acgatcacgacacgcgaggcgccaatgaagcagttgcttcgagagttgacaatcatgtct
tcaaccaagcatgtcaatatcatcaccttctatggagcttacatgtcgccgtcttcgagc
gagatcaagatcattatggaatactgcgagggagggagtttggagtctgtggggaagagg
atcagggagcggggtgcgattgtcggagagaagattgcaggtcggttggccgaaggggtt
ctccaaggactctcgtatctgcattcaaagaagacgatccaccgtgatatcaaaccctcc
aatattcttctgtcgaaggaaggagtggtcaagctttgcgacttcggtgtctctggagag
ctgatcttgtcgcaagctggaacgttcacgggaacgagcttctatatggcccctgaacgt
atacagggcaaagagtataccatccgttccgacgtctggtcaaccggaatctcgctcctc
gaactcgtccaaaaccgattccctttcccccctgatctcccgccgatagagttgatgatg
tacattacgaatagcgagcccccccgccttgaggatgaacctggcgtcaactggagcgaa
gaaatgaaagacttcattaagcaagcgctcaccgtggaccctgttgatcggccaaccccg
aaggatatgttagaacacccgtggattaagaatatgatgaagtacgagaacaccatggga
agatggattgctcaggtctggggctggtcgcggtcgaagaaatccagggatgaaagctct
tcacgaccgggtacagcgtctggaacgccttga

DBGET integrated database retrieval system