KEGG   Coprinopsis cinerea: CC1G_02006Help
Entry
CC1G_02006        CDS       T01275                                 

Definition
anthranilate synthase
Orthology
K13501  
anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
cci  Coprinopsis cinerea
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CC1G_02006
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CC1G_02006
Enzymes [BR:cci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CC1G_02006
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CC1G_02006
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CC1G_02006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 825 aa AA seqDB search
MSATQSTLPPHLQGQLDVLMIDNFDSFTWNLYQQLCLAGANVTVIRNDAIDESQLPLLKI
KHLIISPGPGHPQTDSGISRAAIKYFEGKVPIFGVCMGLECVVDVYGGTIAYAGEIMHGK
VSKVRHDNRGCFKGIPQGIKSIRYHSLSAALSTLPAELAVTSVTEESGVIMGVRHRKYAI
EAVQYHPESILSEGGDELIRNFLSLRGGTWEVNPEAQVLDQSLPPFPIENLPREISSNPA
AAKKVPSILDKIYAQRLNDVALAQRTPGTTLADLETLYALNVAPPLISFTERIKSETGRP
SLFAEIKRASPSKGPISVATSPATQALTYALSGAAVISVLTEPKWFLGSLQDMLHARNSV
AHLPNRPAILRKDFILSRYQILEARIWGADTVLLIVSMLPEGLLRDLYAYSLELGMEPLV
EVNNAKEMEIALSLGSKVIGVNNRNLHDFQVDMNTTSRLADMTKGHDVTLCALSGISGPE
DVNRYASEGVGAVLIGESLMRAEDPSAFIRDLFSLPEAPVQPPKWRSRLPLVKICGVRSK
DEAVAIATAGADMIGLMFVEKSKRRVDWDTAKEISKAIRELRFDAPPAVSEETPDTPNTP
WLTSHANRLSESSPNSRPRLVGVFQDAPLSQILKTVAEIQLDMVQLHGSEPIEWAQQIPV
PVIRVFHVTADGKGLEGITRPGAHQFVLLDSVRDDGSGMSGGSGKVVDLDLAKRVVAAGE
INVGGTAAYAGAGKEAGDEEENGQVKTSKQASVNYPLPIILAGGLTASNVAAAISKVQPW
AVDVSGGVENATQGGKDLSKVQAFIDAAKGLTNSDEEDATDGIAA
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaacccagtcgacccttccccctcatcttcagggccagctcgatgtcttgatg
atagacaacttcgactctttcacctggaatctttaccaacaactgtgcctcgccggggcg
aatgtcaccgtcatccgcaacgatgctatcgacgaatcccagctgcctttgctcaagata
aagcacttgatcatctcgccgggccctggccatcctcagaccgactctggtatctcgagg
gccgcgatcaaatacttcgagggcaaggtccccatctttggagtgtgcatgggtttggag
tgtgttgtggatgtctatggcggtacaattgcttacgccggagaaatcatgcacggcaaa
gtcagcaaggtcagacacgacaatcggggctgcttcaagggcatccctcaaggaatcaaa
tctattcgatatcactctctcagtgcggcgttatctacccttcctgccgagctcgccgtt
acttccgttaccgaagagtcgggggtcatcatgggcgtccgacaccggaaatatgccatc
gaagctgtccagtaccaccccgaaagcatcctgagtgagggcggcgatgaactcatccgc
aactttctttcacttcggggcggtacttgggaggtcaaccccgaagcacaggttcttgac
cagtccctccctccgttccccatcgaaaacctcccaagagaaatctcttccaaccccgct
gcggcaaagaaggtcccttccatcctcgacaagatctatgctcaacgtctcaacgacgtt
gcccttgcgcagcggacacctggcaccacattggccgatctcgagaccctttacgctctc
aacgtcgcccctcctcttatctcattcaccgagcgtatcaagtcggaaactggtcgaccc
tccctctttgccgaaatcaaacgtgcctccccttccaagggccctatatccgtggcaacc
tctccagcaacccaggctctgacttatgcattgtcaggagctgccgtcatctccgtattg
acagagcccaagtggttcctgggatcgttgcaggacatgttgcacgcacgtaacagtgtt
gcccacctgcccaataggccagctatcctgcgcaaggacttcatcctcagtcgataccag
atcctcgaagctcgcatctggggtgccgatactgtattgctaatcgtcagcatgcttcct
gaagggctcctcagagacctttatgcctactcactcgagttgggtatggagcccctcgtc
gaggtcaacaatgcaaaggaaatggagatcgccctttcccttggctcaaaggtcatcggc
gtcaacaaccgcaacctccacgatttccaagtcgacatgaacaccacaagcagattggcg
gacatgaccaagggccacgatgtcaccctctgtgcactcagtggcatctctggtcccgaa
gatgtcaaccgctatgcatctgaaggtgttggcgccgttctcattggtgagagtcttatg
agggctgaagacccttccgccttcattcgcgacctcttctcccttcccgaagctccggtt
caaccaccaaaatggcgctcccgtctccctttggtcaagatctgcggcgttcgttccaag
gacgaggctgtcgcgatcgccactgccggtgcagacatgatcgggttgatgttcgttgaa
aagtcgaagaggcgggttgactgggacaccgcgaaggagatctccaaagccatccgcgaa
cttcgattcgacgctcctcctgctgtgtccgaagagacccccgacactcccaacaccccc
tggttaacctctcacgccaaccgactctccgaatccagccctaactcccgccctcgactc
gtcggtgtcttccaggatgcccccctttcgcagatcttgaagactgttgctgagatccaa
ctcgatatggttcagctgcacggttcggaacctatcgaatgggctcagcagataccggtg
cccgtcatccgcgtcttccatgtcaccgctgatggcaagggtctcgagggtatcactcgc
ccaggtgctcaccaattcgtcctcctggacagcgtccgcgatgatggatctggcatgagt
ggtgggagtggaaaggtcgttgacttggaccttgccaagcgggtcgtcgcggctggcgag
atcaacgtcgggggaaccgctgcctatgctggcgctgggaaggaagctggcgacgaagaa
gagaacggacaggtgaagacttccaaacaagcatccgtcaactatcccttgcctatcatc
ctggctggcgggttgactgccagcaacgtcgctgctgccatctcgaaggttcaaccctgg
gctgtggatgtcagtggaggtgttgagaatgccactcagggcgggaaggacctctccaag
gtacaggctttcatcgacgccgccaagggtttaaccaactctgatgaggaggatgctacc
gatggcatcgctgcctaa

DBGET integrated database retrieval system