KEGG   Coprinopsis cinerea: CC1G_02007Help
Entry
CC1G_02007        CDS       T01275                                 

Definition
(RefSeq) CMGC/MAPK/ERK protein kinase
Organism
cci  Coprinopsis cinerea
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 438 aa AA seqDB search
MQRRSFTALNSVFCVDAQYEFVKELGQGAYGCVVAARHRQTGEGCAIKKITNINTKRILT
KRCLREIRLLHHFRGHKNITCLYDMDIVFQPNGNFDEVYLYEELMEADLHAIIRSGQPLT
DAHFQSFIYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGYTPGSGTSR
AAGNQGFMTEYVATRWYRAPEIMLSFANYSTAIDVWSVGCILAELLGGRPIFKGRDYVDQ
LNQILHYLGTPSEDTLRRVGSPRAQDYIRSLPIRPRISFSTLFPQANPLAIDLLSRMLCF
DPARRISCEEALNHPYLAVWHDPADEPNCDSIFDFSFEEEDSIEGMKRLIVEEVNNFRAE
VRAQARGSAQNHRSTKDSDNLGIPSRDEIISSPVKEFGPHPGHTSNYTTNAPRAPSPIMD
DPSAELERELASTHISKK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaagatcctttaccgctctcaactctgtcttctgtgtcgatgctcaatacgaa
ttcgtaaaggaattgggccagggtgcttatggctgcgtcgtagcggccagacatcgtcag
acgggtgaaggttgcgctatcaagaagatcaccaatatcaacaccaagcgcatcctcacc
aaacgatgcttgcgagagatcagactgctgcaccacttccgaggtcacaagaacatcacc
tgcctctacgacatggacatcgtattccagcccaatggcaacttcgacgaggtctacctc
tacgaagagctgatggaggctgatctccacgctattattcgttcaggccagcccttgacg
gacgcccatttccaatctttcatttaccaaaccctttgtggcctgaaatatatccattcc
gccaatgtccttcaccgcgatctcaagccaggcaaccttctcgtgaacgccgactgcgaa
ctcaagatctgtgattttggtctcgctagaggatataccccgggaagcggcacgtcgcgt
gcagcaggaaaccaaggatttatgacagaatacgtggccactaggtggtatcgcgcgcca
gaaatcatgttgagcttcgccaactattcaactgctattgatgtttggtctgtcggttgt
atcttggccgagctactcggtggacggcccatcttcaagggtagagactatgtcgaccag
ctgaatcaaatcctccactaccttggcaccccttctgaagacaccctccgccgagtcgga
tctcccagagcccaagattacattcgttccttgccaatccgaccaaggatctcgttctct
acgctcttcccccaggccaatccactcgccattgatctgctttcacgcatgctctgcttt
gaccctgctcgacgtatcagctgcgaggaagctctcaatcacccttatctcgccgtatgg
cacgatcctgctgatgaacccaattgcgactctatcttcgacttcagtttcgaagaagag
gatagtatcgagggaatgaaacgactgattgttgaggaggtcaacaacttccgcgcggaa
gttcgggcgcaagcgcgtggttctgcacaaaatcatcgcagtaccaaggactcggacaac
ctaggtattccgtctcgagacgagattatcagctcccccgtcaaggaattcggtcctcac
cctggccatacgtccaattacaccaccaacgctccccgtgctccgagccctattatggat
gaccccagtgcagagctcgaacgcgagcttgctagcactcatatctccaagaaatga

DBGET integrated database retrieval system