KEGG   Coprinopsis cinerea: CC1G_02007Help
Entry
CC1G_02007        CDS       T01275                                 

Definition
CMGC/MAPK/ERK protein kinase
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
cci  Coprinopsis cinerea
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cci00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CC1G_02007
Enzymes [BR:cci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CC1G_02007
Protein kinases [BR:cci01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CC1G_02007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 438 aa AA seqDB search
MQRRSFTALNSVFCVDAQYEFVKELGQGAYGCVVAARHRQTGEGCAIKKITNINTKRILT
KRCLREIRLLHHFRGHKNITCLYDMDIVFQPNGNFDEVYLYEELMEADLHAIIRSGQPLT
DAHFQSFIYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGYTPGSGTSR
AAGNQGFMTEYVATRWYRAPEIMLSFANYSTAIDVWSVGCILAELLGGRPIFKGRDYVDQ
LNQILHYLGTPSEDTLRRVGSPRAQDYIRSLPIRPRISFSTLFPQANPLAIDLLSRMLCF
DPARRISCEEALNHPYLAVWHDPADEPNCDSIFDFSFEEEDSIEGMKRLIVEEVNNFRAE
VRAQARGSAQNHRSTKDSDNLGIPSRDEIISSPVKEFGPHPGHTSNYTTNAPRAPSPIMD
DPSAELERELASTHISKK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaagatcctttaccgctctcaactctgtcttctgtgtcgatgctcaatacgaa
ttcgtaaaggaattgggccagggtgcttatggctgcgtcgtagcggccagacatcgtcag
acgggtgaaggttgcgctatcaagaagatcaccaatatcaacaccaagcgcatcctcacc
aaacgatgcttgcgagagatcagactgctgcaccacttccgaggtcacaagaacatcacc
tgcctctacgacatggacatcgtattccagcccaatggcaacttcgacgaggtctacctc
tacgaagagctgatggaggctgatctccacgctattattcgttcaggccagcccttgacg
gacgcccatttccaatctttcatttaccaaaccctttgtggcctgaaatatatccattcc
gccaatgtccttcaccgcgatctcaagccaggcaaccttctcgtgaacgccgactgcgaa
ctcaagatctgtgattttggtctcgctagaggatataccccgggaagcggcacgtcgcgt
gcagcaggaaaccaaggatttatgacagaatacgtggccactaggtggtatcgcgcgcca
gaaatcatgttgagcttcgccaactattcaactgctattgatgtttggtctgtcggttgt
atcttggccgagctactcggtggacggcccatcttcaagggtagagactatgtcgaccag
ctgaatcaaatcctccactaccttggcaccccttctgaagacaccctccgccgagtcgga
tctcccagagcccaagattacattcgttccttgccaatccgaccaaggatctcgttctct
acgctcttcccccaggccaatccactcgccattgatctgctttcacgcatgctctgcttt
gaccctgctcgacgtatcagctgcgaggaagctctcaatcacccttatctcgccgtatgg
cacgatcctgctgatgaacccaattgcgactctatcttcgacttcagtttcgaagaagag
gatagtatcgagggaatgaaacgactgattgttgaggaggtcaacaacttccgcgcggaa
gttcgggcgcaagcgcgtggttctgcacaaaatcatcgcagtaccaaggactcggacaac
ctaggtattccgtctcgagacgagattatcagctcccccgtcaaggaattcggtcctcac
cctggccatacgtccaattacaccaccaacgctccccgtgctccgagccctattatggat
gaccccagtgcagagctcgaacgcgagcttgctagcactcatatctccaagaaatga

DBGET integrated database retrieval system