KEGG   Coprinopsis cinerea: CC1G_02047Help
Entry
CC1G_02047        CDS       T01275                                 

Definition
ubiquitin-specific protease
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
cci  Coprinopsis cinerea
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 323 aa AA seqDB search
MSDEDSNSGWQLTESDPGVFTELLKSLGVPLIVDDLYSLDAESLAALKPIHALIFLFKWV
PTKDSDGGPAGTYDPDFPGFFAHQVVNNACATLAVVNALGNIPSLPTGPQLAELLSFTTG
MDPQTRGLVLTSADWLREAHNALSPPNAISLDGLELPRQAEEAYHFVVYLPYMGAVYELD
GLKPHAVRHGAYEESGEGWLKTAREVIEARINTYPMGALEFSLLALHDDPLPTLQSQLQE
AQTAGNSAVEADLLARISNENAKRENWAFENSLRRHNHVSLVHGLLLALAKIGKLEPATT
KAKETMKEKIKKKKESGEAMDED
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgaagacagcaacagtggctggcagttgacagagtcggatcctggagtgttc
acggaacttttgaaatctctcggagtgccgttaattgtcgatgatctctactcgttagac
gccgaatcactggccgcactcaaacccatacacgccctcatcttcctattcaaatgggta
ccgacaaaagattcagacggcgggcctgcaggaacatacgatcccgatttccctgggttc
ttcgcccaccaagttgtcaacaacgcctgtgcaaccctggctgtcgtaaatgcgctgggg
aacatcccctcgctaccaacaggcccacagttggcggagctgctgagcttcaccaccgga
atggatccacagactcgtggtttggtcctcacgagcgccgactggttgagggaagcccac
aacgcactgtctccacccaatgccatctctttggatggtttggaattgcctagacaggcc
gaagaggcttatcacttcgttgtgtacctgccctacatgggggcagtgtatgagcttgac
ggcttgaaaccacatgctgtccggcatggagcgtacgaggagtcgggagaagggtggttg
aagactgcaagagaggtaatcgaagctcggataaatacctatccaatgggagctctcgaa
ttcagccttttggctttgcacgatgacccccttcctacgctccagtctcaactgcaagag
gcgcagactgctggaaacagcgccgtagaggcagatctccttgccaggatttccaacgaa
aacgcgaaacgcgaaaattgggctttcgagaacagtctcaggcggcacaatcatgttagc
ctagtacatgggttgcttttagctctggctaaaattgggaagctggaaccagcaacgact
aaagctaaggagactatgaaggaaaaaatcaagaagaagaaggagtccggagaagctatg
gacgaagattga

DBGET integrated database retrieval system