KEGG   Coprinopsis cinerea: CC1G_02205Help
Entry
CC1G_02205        CDS       T01275                                 

Definition
STE/STE7/MEK1 protein kinase
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
cci  Coprinopsis cinerea
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 437 aa AA seqDB search
MTDLFVQASGPLRTKRNFKGLALSAEPPSPPPPGGKKRPPPLGAAMALGGGPAPLGGLPL
LDDLPGESPATGRHSAMQATLSDKLAKLELKKRIKDLKNDDLKKLSDLGQGNGGSVEKVE
HLPTGTIMAKKSVLIDAKSSVRKQILRELDIMHECQSDYIISCFGSFLAEPNICICMEFM
DKGSFDGIYKKLGPLQVEVVGMVALSVLEGLTYLYDVHRIMHRDIKPSNILFNSQGQIKL
CDFGVSGEVINSIANTFVGTSVYMSPERIQSHGDGYSVKSDVWSLGMSLVELALGAFPFT
DPPDDDDDDLSDLEGDSSSPSPSDAQHQRTPTHRDSFLLSKKTAKRASKRRSKLTYNPDG
QLSTMSIFELIHQIVQEPSPRLPSDKFPADAVDLVDICLLKNPEERQTPKALLVRNHPWI
VAIRESDFDIQAFAATV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccttttcgtgcaagcctcaggccctctacggacgaaacgaaacttcaaaggc
ctcgctctgagcgcggaacctccctccccacctcctccaggcggaaagaagcgaccaccg
cctctcggtgcggctatggcgctcggaggcggcccagcaccactgggcggactcccactt
ttggacgacctaccaggtgaaagccccgcaaccggccgccacagcgccatgcaagccacc
ctctccgacaagctcgccaaactcgaactcaagaaacggataaaagacctcaaaaacgac
gatctcaagaagctctccgatctgggacagggtaatggcggaagcgtggagaaagtcgag
catctcccgacaggaactatcatggctaagaagagtgttctgatcgatgccaaatcgtcc
gtcaggaagcagatcctccgcgaactcgacatcatgcacgagtgccaatccgactacatc
atctcatgctttgggtcgttcctggcagaacccaacatctgcatctgtatggaattcatg
gacaaagggtccttcgacgggatctacaagaaactgggaccgctgcaggtcgaggttgtg
gggatggtcgcgctttccgtcttggaaggcctgacgtatctgtacgatgttcatcgcatc
atgcatcgcgacatcaaaccctcaaacatcctcttcaactcccaaggacaaatcaaacta
tgcgactttggcgtgtccggcgaagtcatcaactccatcgcaaacaccttcgtagggaca
tcagtctacatgagccccgaacgcatccaaagccacggcgacggctactcggtcaaatcc
gacgtctggtccctcggcatgtccctcgtcgaactcgcattgggtgcattccccttcaca
gacccaccagacgacgacgacgacgacctctccgacctcgaaggcgactcctcgagtcca
agtccatcggacgcccaacaccaacgcacacccacacaccgcgactcgttcctcctcagc
aaaaagaccgccaaacgcgcaagcaagcgcagaagcaaactcacctacaacccagatggg
cagttgtccaccatgagcatctttgaactgatccatcaaatcgttcaggagccctcacct
cgactcccgagcgacaaattcccagctgatgccgtggacctggtggatatctgtttgttg
aagaacccagaggagaggcaaacgccgaaagcactattggtacggaaccatccatggatt
gtcgccatccgagagtcagactttgacattcaagcctttgccgccaccgtttaa

DBGET integrated database retrieval system