KEGG   Coprinopsis cinerea: CC1G_02260Help
Entry
CC1G_02260        CDS       T01275                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cci  Coprinopsis cinerea
Brite
Enzymes [BR:cci01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CC1G_02260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 383 aa AA seqDB search
MSFNLLRASVRNANPIRRAAAGKAPRNLPSVVRAAPRGRQYSTAPPPPEAKSSSSGLLWG
LGAAGAAGVAYFFFQGDAENVVKGGVQSAKAATHFTPSKEDYQKVYNRIADLVADAGDYD
DGSYGPVLLRLAWHSSGTYDKESNTGGSNYATMRFEPESLHGANAGLNVARELMEKVKQE
FPWISYGDLWTLAGVAAIQEMGGPKIPWRPGRIDGVASQATPDGRLPDASQGADHLRQIF
YRMGFNDQEIVALSGAHALGRAHRDRSGYDGPWTFSPTTVTNDFFKLLFDEKWVWKKWEG
PKQYEDKKTKSLMMLPTDYVLTQDKSFKKHAKAYAEDQDLWFKDFSKAVSRLFELGVPTS
QFVTSEPWIMANVDEQPAPEEKK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcaaccttcttcgcgcatccgtccgcaacgccaaccccatccgccgcgccgct
gctggcaaggccccacgaaacctcccctcagtggtcagggctgcccctcgaggtcgccaa
tactcgaccgcaccaccccctcctgaggccaagtcgtcgagctctggtctcttgtggggt
ctcggtgctgctggtgctgctggtgttgcctacttcttcttccaaggcgacgcagagaac
gtcgtaaaagggggcgtgcaatctgccaaggccgccacccactttacccccagcaaggag
gactaccagaaggtttacaaccgcattgctgacctcgtcgccgatgctggagactatgat
gacggctcctacggacccgttcttctccgtctcgcctggcactcgtctggtacctacgac
aaggagtccaacactggtggaagcaactatgctaccatgcgattcgagcctgaatccctg
cacggcgccaacgctggtttgaacgtcgctcgtgaattgatggagaaggtcaagcaggag
ttcccttggattagctacggtgacctctggactctcgccggtgtcgctgctattcaggaa
atgggcggccccaagatcccctggagacccggacgaattgacggtgttgcctcccaagcc
actcccgacggtcgtcttcccgacgctagccagggtgctgaccacttgcgacagatcttc
taccgtatgggattcaatgatcaggagattgttgccttgtctggtgcccacgccctcgga
cgtgcccaccgcgaccgatccggctacgacggtccctggaccttctcccctaccactgtg
accaacgacttcttcaagctgttgttcgatgagaagtgggtctggaagaagtgggaggga
cccaagcagtacgaggataagaagaccaagtctctcatgatgttgcctaccgactatgtc
ctcactcaagacaagagcttcaagaagcacgccaaggcctacgctgaggaccaggacctc
tggttcaaggacttctccaaggccgtctcccgcctcttcgaactcggtgttcccacttca
caattcgtcacctccgagccctggatcatggccaacgtcgatgagcagcccgctcctgag
gagaagaagtaa

DBGET integrated database retrieval system