KEGG   Coprinopsis cinerea: CC1G_02345Help
Entry
CC1G_02345        CDS       T01275                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
cci  Coprinopsis cinerea
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CC1G_02345
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CC1G_02345
   00630 Glyoxylate and dicarboxylate metabolism
    CC1G_02345
Enzymes [BR:cci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CC1G_02345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 545 aa AA seqDB search
MTTVNVPGIQVLSNQAPKAQAELFTDGALKFLAALHRTFESTRQSLLTAREEAQRRYDAG
AVLDFPPETQAVRDDPSWQCAPPAPGLEDRRVEITGPTDRKMVINALNSGAQTFMADFED
SSSPTFANMLNGQINLRDAIRRQIDFETNGKKYKLSENPATLIVRPRGWHLDEPRVLIDN
QPVSASIFDFALFFYHNAKEQVKRGKGPYFYLPKMEHYLEARLWNDIFVFSQHYIGLPQG
TIRGTVLIETIPAAFHMEEILFELREHSSGLNCGRWDYIFSFIKKRRADRSAVLPDRKDV
TMTVPFMDAYVRLLINTCHRRKVAAMGGMSAQIPIKDDPKANEIAMAKVRADKLREVTAG
HDGTWIAHPLIEPIARGIFDQHMLGPNQYHNRRLDVKVTAADLLNTTVPGKITLDGVREN
VSTCLAYTAAWVGGNGCIPYNYLMEDAATAEITRIQLWQWVKYGMRVDDTGELITVEYVD
KLVEELAPTIKKIVAGVKDENVHIAKEYLRSQIRRQWPSEFLTSDLMPFLAVRDGVPPKF
QKAAL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgttaacgtccccggcatccaggtcctctccaaccaggcgcccaaggcccaa
gccgagctcttcaccgacggagccctcaagttcctcgccgccctccaccgcaccttcgag
tcgacaaggcagtcgctgctgactgcccgcgaggaggcccagaggcgctacgacgccggc
gccgtcctcgacttcccacctgagacacaggccgtccgggacgaccccagctggcaatgc
gccccacccgctcctggtcttgaggaccgccgtgtcgagattaccggccccactgatagg
aagatggtcattaatgcgctgaatagtggtgcgcagacgttcatggctgattttgaggat
tcgtcctcgcctacgtttgcgaacatgcttaatggccagatcaacttgcgcgatgctatc
cgtcgccagattgatttcgagaccaatggcaagaagtacaagctctctgagaaccctgct
accctcatcgtccgtccccgaggatggcacctcgacgaaccccgcgtcctcatcgacaac
cagcccgtctccgcctccatcttcgactttgccctcttcttctaccacaacgccaaggag
caagtcaagcgcggcaaaggcccctacttctacctcccgaagatggagcactacctcgag
gcccgcctctggaacgacatcttcgtcttctcgcagcactatatcggtctgccccagggc
acgatccgcggaaccgtcttgattgagactatccccgctgccttccacatggaggagatc
ctctttgagttgagggaacattcgagtggattgaactgtggacgatgggattatatcttc
agcttcattaagaagcgacgggctgaccgctctgctgtcctccctgatcgcaaggacgtc
actatgaccgttcctttcatggacgcctacgtccgtctcctcatcaacacttgccacagg
cgcaaggtcgcagccatgggtggcatgtccgctcagatccccatcaaggacgaccccaag
gccaacgaaatcgccatggccaaggtccgcgccgacaagctccgcgaggtcaccgccggg
cacgacggcacctggatcgcgcacccgctcatcgagcccatcgcgcgcggcatcttcgac
cagcacatgctcgggcccaaccagtaccacaaccgccggctcgacgttaaggtcaccgcc
gcggacctcctgaacaccaccgtccccggcaagatcacgctcgacggcgtgcgcgagaac
gtgtcgacgtgccttgcgtatacggctgcgtgggtcggtgggaacggctgtatcccgtac
aactacctcatggaggacgctgccaccgctgagatcacgcgtatccagctgtggcagtgg
gtcaagtacggtatgcgggtggacgataccggtgagcttatcactgtcgagtatgtggat
aagcttgtggaggagttggcgcctacgattaagaagattgtggcgggtgtgaaggatgag
aatgtgcatattgcgaaggagtatttgaggagtcagattaggaggcagtggccttccgag
tttttgacgagtgatttgatgccgttccttgctgttcgggatggtgttccgcccaagttc
cagaaggcggctttgtaa

DBGET integrated database retrieval system