KEGG   Coprinopsis cinerea: CC1G_02345Help
Entry
CC1G_02345        CDS       T01275                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
cci  Coprinopsis cinerea
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:cci01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cci00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:cci00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 545 aa AA seqDB search
MTTVNVPGIQVLSNQAPKAQAELFTDGALKFLAALHRTFESTRQSLLTAREEAQRRYDAG
AVLDFPPETQAVRDDPSWQCAPPAPGLEDRRVEITGPTDRKMVINALNSGAQTFMADFED
SSSPTFANMLNGQINLRDAIRRQIDFETNGKKYKLSENPATLIVRPRGWHLDEPRVLIDN
QPVSASIFDFALFFYHNAKEQVKRGKGPYFYLPKMEHYLEARLWNDIFVFSQHYIGLPQG
TIRGTVLIETIPAAFHMEEILFELREHSSGLNCGRWDYIFSFIKKRRADRSAVLPDRKDV
TMTVPFMDAYVRLLINTCHRRKVAAMGGMSAQIPIKDDPKANEIAMAKVRADKLREVTAG
HDGTWIAHPLIEPIARGIFDQHMLGPNQYHNRRLDVKVTAADLLNTTVPGKITLDGVREN
VSTCLAYTAAWVGGNGCIPYNYLMEDAATAEITRIQLWQWVKYGMRVDDTGELITVEYVD
KLVEELAPTIKKIVAGVKDENVHIAKEYLRSQIRRQWPSEFLTSDLMPFLAVRDGVPPKF
QKAAL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgttaacgtccccggcatccaggtcctctccaaccaggcgcccaaggcccaa
gccgagctcttcaccgacggagccctcaagttcctcgccgccctccaccgcaccttcgag
tcgacaaggcagtcgctgctgactgcccgcgaggaggcccagaggcgctacgacgccggc
gccgtcctcgacttcccacctgagacacaggccgtccgggacgaccccagctggcaatgc
gccccacccgctcctggtcttgaggaccgccgtgtcgagattaccggccccactgatagg
aagatggtcattaatgcgctgaatagtggtgcgcagacgttcatggctgattttgaggat
tcgtcctcgcctacgtttgcgaacatgcttaatggccagatcaacttgcgcgatgctatc
cgtcgccagattgatttcgagaccaatggcaagaagtacaagctctctgagaaccctgct
accctcatcgtccgtccccgaggatggcacctcgacgaaccccgcgtcctcatcgacaac
cagcccgtctccgcctccatcttcgactttgccctcttcttctaccacaacgccaaggag
caagtcaagcgcggcaaaggcccctacttctacctcccgaagatggagcactacctcgag
gcccgcctctggaacgacatcttcgtcttctcgcagcactatatcggtctgccccagggc
acgatccgcggaaccgtcttgattgagactatccccgctgccttccacatggaggagatc
ctctttgagttgagggaacattcgagtggattgaactgtggacgatgggattatatcttc
agcttcattaagaagcgacgggctgaccgctctgctgtcctccctgatcgcaaggacgtc
actatgaccgttcctttcatggacgcctacgtccgtctcctcatcaacacttgccacagg
cgcaaggtcgcagccatgggtggcatgtccgctcagatccccatcaaggacgaccccaag
gccaacgaaatcgccatggccaaggtccgcgccgacaagctccgcgaggtcaccgccggg
cacgacggcacctggatcgcgcacccgctcatcgagcccatcgcgcgcggcatcttcgac
cagcacatgctcgggcccaaccagtaccacaaccgccggctcgacgttaaggtcaccgcc
gcggacctcctgaacaccaccgtccccggcaagatcacgctcgacggcgtgcgcgagaac
gtgtcgacgtgccttgcgtatacggctgcgtgggtcggtgggaacggctgtatcccgtac
aactacctcatggaggacgctgccaccgctgagatcacgcgtatccagctgtggcagtgg
gtcaagtacggtatgcgggtggacgataccggtgagcttatcactgtcgagtatgtggat
aagcttgtggaggagttggcgcctacgattaagaagattgtggcgggtgtgaaggatgag
aatgtgcatattgcgaaggagtatttgaggagtcagattaggaggcagtggccttccgag
tttttgacgagtgatttgatgccgttccttgctgttcgggatggtgttccgcccaagttc
cagaaggcggctttgtaa

DBGET integrated database retrieval system