KEGG   Coprinopsis cinerea: CC1G_02656Help
Entry
CC1G_02656        CDS       T01275                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
cci  Coprinopsis cinerea
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 256 aa AA seqDB search
MSDDRLRWIPLESNPEVFNKWAKRAGLITGQDAFTDVYGLDPELLAMVPQPVKAVVLLFP
DSPDTHKQKNEEDARIAAQGGQPHLDPTIFYVKQKISNACGTIALIHALANSDVTWAPNS
PLHNFIVDGKDKTPEERADLLQSRTLFSDIHAESAQEGQTIPDVNTDLHFTCFVAAPDAD
IRKVATGEESPDQVSTGGDGDTGLRLVELDGRRPGPIDHGVCTDLLNDVAALVKKRYLAK
TESVYFNLMALAPPLQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgatcgccttcgatggattcctttggagagtaaccctgaggtctttaacaag
tgggcgaaacgcgctggtctgatcacaggccaggacgcgttcacggatgtgtatggattg
gacccagagcttctggcgatggtaccccagccagtcaaagccgtcgtccttctcttcccc
gacagtccagacactcataagcagaagaacgaggaggacgcacggatagctgctcaaggt
ggtcaaccccacctcgatcctacgatcttctacgtgaagcagaagatcagcaatgcttgc
ggcactatcgcccttatccacgctctcgccaattcggatgtaacttgggcacccaacagc
cccctccacaactttatcgttgacggaaaagacaagacgccagaagaacgagcagatctc
ctccagtccaggaccctgttctccgacattcacgctgaaagtgctcaggaaggccagacg
atcccagatgtgaacacggatctccacttcacctgcttcgtcgctgcgccagatgccgat
ataagaaaggttgcgaccggagaagagtcgccagatcaggtttcgactgggggcgatgga
gatactggattgcgcctcgtcgaattggatggacgacgacctggacctattgaccatggt
gtctgcacagacttgttgaatgacgtggcggcccttgtcaagaagcgatacctggccaag
actgaaagtgtttacttcaacttgatggccctcgccccacccttgcagtag

DBGET integrated database retrieval system