KEGG   Coprinopsis cinerea: CC1G_03033Help
Entry
CC1G_03033        CDS       T01275                                 

Definition
other/TTK protein kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
cci  Coprinopsis cinerea
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:cci04111]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 1005 aa AA seqDB search
MSTSPSISPPRTPNDNRPTASTSNSPSSDDSSIIDDLSFDYVYDDNGNVVRLSRKSNSTS
PPTDQESLPDSALDNDSPAGSPLNRQSLSRSESAQSILQGTSAAATDPKPARPFQRVAST
PSYLLPTAAATSRAAVTRGGPRRIIEDSHNRERQEPIVRSRQTFDYATRDSYAHQEEKEN
ILAEMDERPQLVNRRNSPPLIARSTASRFSSARISYSTIGGSLNGRPLADVPVQRTARQP
PTGLTRPGRLMKSSLTSLKYSTSNQDRLSDVVESSDYEHKQQGLPEPNPYAPPASDTEPE
DEPLEPSAIPLRSSLNPRQRKELNINAQAASLAQSGSNRPRRSASLSDALYPHDDYQLQV
AAPPTHGHSRPGTSLGLNAESGPRRVYPEERERQELEAHKKLRREHEDDRQSPSPTHGHP
QHQRLVANGHRRRDSDTLRGLAPPNSAGTVGSPTVMDMPNGRPSPTGHRFPHGRSSPAAT
VRGRQSPQTVKGRVSPPATKGRVSPANAGNRLGVSRDAGKHRRSPTAPEPPTTSGQIGGH
EQPPGSKTWGGSEREDEFDPASSGEKDREKERERQLEAQRERRERREQQQQQQPPPQPPP
QQLQPYAQVPQAIAQPAAPAPQPPIPAPNQLNRHIVVNKKAYARIDIIGKGGSSRVFRVL
NHANELYAIKRVSLDKTDAETMSGYMNEIALLKRLEGNSRIIRLIDSEVKPGPGGSKGHL
LLVMECGEIDLAKLLQEQMKEPLNMVWVSYYWQQMLQAVHVIHEEKIVHSDLKPANFVLV
KGQLKLIDFGIANAIANDTTNIQRDHQIGTVNYMSPEAIELPDGMRRLKVGRPSDVWSLG
IILYQMVYGHPPFQHLSVYQKMKAIPDLSHVIEYPEYTVPSIPAKTSSNGTVEPPKRLEH
LKRRVRADVIRGIKSCLCRNPKERATIPELLEQPWLGLTGNEPEPVRPRIEDMLGEKETL
INPYYMAQLMQYCVKLAREDKPMDAETLQKDAEVRELVVPMLADN
NT seq 3018 nt NT seq  +upstreamnt  +downstreamnt
atgtccacttcgccctcaatttccccgcctcgcacaccaaacgacaaccggcctaccgct
tcaacctcaaactccccaagttcagatgattcttcaataattgacgacctttctttcgac
tatgtctacgacgacaatggcaacgtcgtccgtctgtccagaaaatcaaactcgacatct
cccccaaccgaccaagaaagtttgccagattcagccctcgacaacgacagtcctgcaggc
tcacctctcaaccgccaatcactatctcgctcggaaagcgcccagtcaatacttcagggt
acatccgcagcggctaccgacccaaaacctgcaagaccctttcaacgcgtcgcgtcaacc
ccatcgtatcttcttccaacagctgcagcgaccagtcgagcagctgtaacgcgcggaggt
cctcgccgtattattgaagacagtcataatcgggaacgacaggagccaatcgtccgatcg
aggcaaacttttgactatgccacgcgcgattcatacgcgcaccaagaggagaaagagaat
atcctcgctgagatggacgaaaggcctcaactcgtcaacagacggaattcccctccactt
atcgcccgctccacagcttcacggttctcctcggcacggatatcgtactcgactatcggt
ggaagtctcaatggtcgccctttagctgacgtccccgttcagcggaccgcacggcagcca
ccgaccggtctaacgcgacctggtcgcctcatgaaatcgtcgttgacctcgctcaaatac
agcacgtccaaccaagaccgcttgagcgacgtggtcgagagttccgattatgagcacaag
caacaaggcctacccgaaccaaatccctacgcgccgcctgcttccgatacggagccggag
gacgagcctctggaaccttccgccattccccttcgctcttcgctcaacccacggcaacgc
aaagaactcaacatcaatgcccaagctgcaagcctggctcaatctggcagcaaccgtcca
aggagatcagctagtctcagtgatgcactatacccccacgacgactaccaactccaagtg
gccgctccacctacacacggacattcccgcccagggaccagccttggtttgaacgccgaa
tcaggtccaaggcgcgtctatcctgaggagagagaacgacaggaattagaggcccacaag
aaactccgcagagaacacgaggacgatcgacaatcaccctcaccaacacacggccatccc
caacatcaaaggcttgtcgccaatggccatcgtagacgcgactcggatacgcttcgtggt
ttggctcctcccaattctgcaggcactgttggatcccctaccgtgatggatatgcccaat
ggtcgaccatcgcccacggggcatcgtttcccccatgggcgctcgtctccagcagcaacc
gttcgtggaagacagtctccccaaacagtcaaaggacgcgtctctccgccagccaccaaa
ggtcgcgtgtcccccgccaatgccggtaatcgcctaggtgtcagtagggatgcgggaaag
catcgtcgcagcccgaccgcccccgaacctccaacgacgagtggccaaatcggtggccat
gaacaaccgcctggttccaagacatggggtggcagtgagcgcgaggacgagtttgatcct
gccagctccggggagaaggatcgggaaaaggagcgggaacggcaattggaagcccaacgg
gagaggagggagcgcagggaacaacagcagcagcagcaaccaccccctcaacctccacca
caacaactccaaccctacgcacaagtgcctcaggctattgcccagcccgctgcacctgca
ccacaaccaccgataccggctcccaatcagctcaaccgtcacattgtggtcaacaaaaag
gcttacgctcgcattgacatcattggcaagggagggtcgtcacgcgtattccgggttttg
aaccacgccaacgaactatacgcgattaaacgcgtctctctggacaagacggatgctgag
acgatgagtggctacatgaacgaaatcgcacttctcaagcgactcgaaggcaatagccgt
atcattcggttgatcgacagcgaagtcaaacctggtcctgggggaagcaaggggcatcta
ctgttggtgatggagtgcggcgagatcgatttggccaagcttctccaggaacagatgaag
gagccattgaacatggtttgggtttcgtactactggcaacagatgctgcaagccgtccat
gtcattcacgaagagaagattgttcattccgacttgaagcctgcaaactttgtgttggtc
aaaggccagctcaagttgattgactttggtatcgcgaacgcgattgcgaatgacactacc
aatattcaacgtgaccaccagatcggtacggtcaactacatgagtcccgaagctatagag
cttccagacggtatgcgtcgactgaaggtcggccgtccgtctgacgtttggtcgttgggt
atcatcttgtaccagatggtgtacggacacccacccttccaacatctttccgtgtatcag
aagatgaaggctattcccgacctcagccatgtcatcgaatatcccgaatacacagtccca
tcgatcccagccaagaccagcagcaatggaaccgtggaacctcccaaacgactggagcac
ctcaagcgacgcgtgcgagcagacgtgatcaggggcatcaagagttgtctttgccgcaac
cccaaggagcgcgcgacgatccccgagttgttggagcagccttggctgggtttgaccggt
aatgaacctgaacctgtgcgtcccaggattgaagatatgctaggcgaaaaggagactttg
atcaatccatactacatggctcagctcatgcagtattgtgtcaagctcgcccgggaagac
aagccaatggacgccgaaactttgcagaaggatgccgaggttcgtgaactcgttgtgcca
atgctagccgacaactga

DBGET integrated database retrieval system