KEGG   Coprinopsis cinerea: CC1G_03225Help
Entry
CC1G_03225        CDS       T01275                                 

Definition
histone acetyltransferase NGF-1
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cci  Coprinopsis cinerea
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 629 aa AA seqDB search
MKLAYPTGSDIFALHNSLLAVKIARHSPCAVCSSSCQGMHPPKGVRIVMDVQDESSGVDD
YSHLFNESDDEDDGIPASGYLEICACGHDCKSHHADEDELGKREFKRRAALAIRMDELLK
DSGRLLDFEYTDDDINNLRKQMVIPYKRESISPGKRLPIDPVSTAHITYAERRQSVPLSS
PASSSLSELDPSSALSGRKRRASTSSLSEAVDDPDPEENEDDDSDEEEDKPLASRLLGAN
APGRSVLGKAKRTTPSKRSRSGKAGGKKAKRVHTIASDDDDDEDDDKPHGQVNGVNGHKK
VKEEKAEAAVLADATAARPVVPTGQRAEKISSVELRRGVIQVVPVKQDGEPRSLIILTGL
KTLFQKQLPVMPREYISRLVYDDNSRSLAIIKRGYKVVGGICFRPFPHRGFAEIVFFATN
SADQEKGYGGMLMDYFKAHIRKEYPDMNHFLTYADNYAVGYFEKQGFTKEITLDKSVWAG
YIKDYEGGTIMQCTMIPKVDYLEKKRIFNEQHDAILEKIRQMSRAHIVYPGLPQFQPGQP
EGVTVDPRDVPGLRESGWTPEMDKELRNLKSPDHHLMEKTLATLRADSHAWPFQTPVTIE
AVPDYFDVIKHPMGKHDTPLTFSSCLPPT
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgcttaccccacggggagcgacattttcgccctccacaactccctgcttgct
gtgaagattgcacgacactcgccatgcgcggtgtgctcaagcagctgtcagggaatgcac
ccgcccaaaggtgtgcgaatcgtcatggacgtccaggacgagtcttctggcgtggacgac
tactcgcacctattcaacgaatcggacgacgaagacgacggaatacctgcctcgggttac
ctggagatctgtgcatgcggtcatgattgtaaatcacaccacgcggatgaggatgagctt
ggaaagagggagttcaagcggagagctgctcttgccatccgtatggatgaattgctcaag
gactctggacgattgctggactttgaatataccgatgatgacattaacaacctccggaag
caaatggtcataccctacaaacgggagtctatttcgccaggcaagcgcctccccattgac
ccagtctcaacagctcacatcacatacgcagaacgtcggcagagcgttccactttcgtcc
cctgcatcatcatccctcagcgaactcgatccttcatctgcactgtcaggtaggaaacgg
cgagcctcaacatcatctctaagtgaagcagtagacgaccccgacccagaggagaacgaa
gacgatgactccgatgaagaggaagacaaaccactagcatcacggttactgggagcaaac
gctcccggaagatctgtactggggaaagcaaagcgtaccacaccttccaagcgaagtagg
agcggcaaggctggcggaaagaaggctaagagggtgcataccattgctagcgacgatgat
gacgacgaggacgacgataagccacatgggcaagtaaatggcgtcaacggacacaagaag
gtcaaggaggagaaagctgaggctgcggtcctagcagatgcaacggccgcacgacccgtt
gtaccaacaggacaaagggctgagaaaatatcatccgtggaactccgtcgaggcgtcatc
caggtcgtcccggtgaaacaggacggtgaacctcgctcgttgatcattctgaccgggttg
aagacgctcttccaaaaacaactaccagtaatgccgcgagaatacatctctcggttagta
tacgatgacaactcgcggtcactcgctatcatcaagcgaggctacaaagtagtgggaggg
atctgttttcgaccgtttcctcatcgaggattcgcggaaatcgtgttttttgcaaccaac
tcagcggatcaagaaaagggatacggaggcatgttgatggattacttcaaagcccacatc
cgaaaagaataccccgacatgaaccatttcctcacctatgccgacaactacgccgtcggc
tacttcgagaaacaaggttttaccaaagaaatcacccttgacaaatccgtttgggcgggt
tatatcaaggactacgagggtggtacgatcatgcaatgcacgatgatacccaaggtggac
tacttggagaagaagcgaatatttaacgagcagcatgatgctattttggagaagatcagg
cagatgtcgagagcgcacattgtgtaccctgggttgccgcagtttcagcctggtcagcct
gagggtgtcaccgtggatccgagagatgtaccgggactgagagaatcggggtggacaccg
gagatggataaagagctacggaatctcaagagcccagatcaccatcttatggagaagaca
ctggccacgttacgagccgacagccatgcctggcctttccaaaccccggttacaatcgaa
gcagtcccggattacttcgacgttatcaagcatccaatgggtaagcatgacacacctctc
acgttctcatcatgcttaccgccgacatag

DBGET integrated database retrieval system