KEGG   Coprinopsis cinerea: CC1G_03377Help
Entry
CC1G_03377        CDS       T01275                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cci  Coprinopsis cinerea
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cci00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 525 aa AA seqDB search
MKHVAVLGAGLSGLSSAFHLSRLHPNVRITVLESQKRAGGWVRSTRVSLPENYGSVLLEA
GPRTLRPNAQSVLELVNLLGLKEQLITVPKTSPAAKSRYLYIPPDHGTSYSGLQQIPSSF
FSFVKSPLSSTLVAAVAQEALKLNNRAKGVEDESVDSFLRRRFGSRFAETFGSAIIHGIY
AADSRNISVRAALPSMWDAEARGWGSLVRGMFMSVKKPQGQAYDAGNVPQLMDGVSVYSF
RDGMETLTRALDSHIRMRPNVQISYNAPVTSLASTEDGFAITVEGGRTVEASHVVSALPT
PILHSILSPTLATTEVNKVGSLTANSTSSVHVVNIVFPGPPCSIHPAGFGYLIPRPPTGY
PSTSPEPTNLGILGTVFDSCSLADQDTEARNPHAYHTAKFTKLTVMIGGPYPLPQLPPYL
SSTEVPQGVDRKTNSLPQYMQTVLEQLAAHLGHWLPTPLYWRIVPNENCIPTLSPGHLER
VDELQGYLDERLGGRLQVVGAGIGGVSLGDCVEAGRTVARRLHFQ
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacgttgcggttctcggcgctggactgtctggcttgtcctctgcttttcacctt
tctcgcttgcacccgaatgtcagaatcacagttctagagagtcaaaagcgtgctggtgga
tgggtacggagtacgcgagtctcactcccagaaaactatggctcggttctgcttgaagcg
ggaccaaggacattgcgccccaacgcccaatctgtgctcgaattggttaatctattagga
ctgaaagaacagcttataacagttccaaaaacctcgccagctgcaaaatcccgctaccta
tacattcctccagaccatggaacgtcgtactctggattacagcaaatcccatcgtcattc
ttctcattcgtcaaatccccactctcttcgactctagtagctgccgtcgctcaagaagca
ctgaagctgaacaacagagcaaagggtgtcgaggatgaaagcgtagattccttccttcgc
cggcgctttgggtctagattcgcggagacttttggaagtgcaatcatccacggaatttac
gctgcggattcgcgaaacatcagcgttagggcggcgctcccgtcgatgtgggatgcagaa
gctcgtggatggggtagcttggttcgggggatgttcatgtctgtgaagaagcctcaaggt
caggcgtatgacgctgggaacgttccccaattgatggatggggtttctgtctattccttc
agagatgggatggaaactctaacgagagcgctggacagtcacattcgaatgcgaccaaac
gtacagatatcatacaatgcaccggtcacttctctcgcatccactgaggacgggttcgcg
ataactgtcgaaggaggtcggactgtggaagcatcacacgtcgtatctgcccttcctaca
cccattcttcactccatcctgtcccccactctagcaaccacagaagtcaataaagttgga
tccttaacagcgaattccacctcctcagtccacgtcgtcaatatcgtattccccggccca
ccttgctcaattcatcctgcaggattcgggtacctcatccctcgccccccgacaggttat
ccctccacctctcccgaaccaaccaaccttgggattctgggtacagttttcgactcttgc
tccctcgcagatcaagacaccgaagcccgtaacccgcacgcataccataccgccaaattc
accaaactcacggtgatgataggcggcccatatcctctgccccaacttcctccatacttg
tcatcaaccgaagtaccccaaggggtcgaccgcaagactaacagtctaccacaatacatg
caaaccgttctcgaacaactcgcagcacatctagggcactggcttccaacaccgctttac
tggcgtatcgtaccgaacgagaactgcatcccgacgctatcgcccggtcacctagaacgc
gtagacgaactccaaggatacctcgacgagcgactgggtggacggttacaggtcgtaggt
gccggtattggaggggttagtttgggtgactgtgttgaggcagggaggaccgttgcacgc
aggcttcatttccaatga

DBGET integrated database retrieval system