KEGG   Coprinopsis cinerea: CC1G_03425Help
Entry
CC1G_03425        CDS       T01275                                 

Definition
beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cci  Coprinopsis cinerea
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CC1G_03425
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    CC1G_03425
   00603 Glycosphingolipid biosynthesis - globo series
    CC1G_03425
   00604 Glycosphingolipid biosynthesis - ganglio series
    CC1G_03425
   00511 Other glycan degradation
    CC1G_03425
Enzymes [BR:cci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CC1G_03425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 609 aa AA seqDB search
MRSLKYLLCLSTITLAHALWPLPRNLETGTNFVKLSPNFDIKLVSNLESSAPEDLLLALT
RTKERIVQDKHQRLTDERGAKDLSNVNEGATLSSLVLSLRNPPDKIQSISVESVKPLEDR
NEVYSLNLPSDGSPATITADTTLGLLRGLTTFEQLWYWVDDDRDGVVYTYQAPVVIKDDS
PSYPYRGLLLDTSRNFFPVDDILRTLDAMSMVKMSVFHWHVVDSQSFPLEVPGYPELSQK
GAYSPSQRYKTEDVQTIVKYASERGIDVLMEIDTPGHTTSVAASHPEHVACAWADPWYNY
AHEPPAGQLRITSEKTREFTVSLLSNIAETLPSSMFGTGGDEINLRCYLDDEQTKIELKD
AGLSIDKKGLDHVLNDFVDATHKALKELKKTPVVWEEIALSHDLTSLSNETIVTVWTDSS
KAADAINKGFRIVHAPSNYFYLDCGGGGWLGNSPTGNSWCDPFKTWQKAYTFDPQDSISP
SKAHLVLGGQQLLWAEQSSPENLDSIVWPRAAASAEVFWTGLHGSERNLTDALSRLHDLR
YRMVQRKIRAIPLQPHWCALQPEKCLAAPWVKSWSIVQNSITEFTRRLIKIGRYLQGSYT
LFGRVIYEF
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgcgatctctgaaatatctcttatgtctttctacgataacgctcgcccacgctctgtgg
ccattgcccagaaacctcgaaaccggaacgaacttcgtcaagctctcaccaaacttcgac
attaaactcgtgtcaaacctcgagtcgagcgcccctgaagacctcctattggccttgacg
cgtactaaggaacgcatagtgcaggacaagcaccaaaggttgacggatgagcgaggggca
aaggacctgtccaacgtgaacgaaggagcgacactttcttcgctcgtactatctctcagg
aacccacctgacaagatacagtcgatctcggtggagtctgtcaagccattggaggatagg
aatgaagtgtactccttgaacctaccgagtgacgggtctcctgcgaccatcacagctgac
acgacgttgggacttctcagaggcctgactacgttcgagcagctgtggtactgggttgac
gatgacagggatggtgtggtgtacacatatcaagcgccagtcgtgattaaagatgacagc
cctagctatccgtaccgcggtctcttgctggacacgtccaggaacttcttcccagtagat
gacatccttcgaaccttggacgcgatgagcatggtcaagatgagcgtcttccactggcac
gttgtcgactcgcaaagcttccccttggaagtacccggataccctgaactatctcaaaag
ggtgcctactcaccttcccagcgatacaagacggaagacgtgcagacgattgtcaagtac
gcgtcggagcgaggcatcgacgttttgatggaaatcgacacgccaggacataccaccagc
gtcgcagcctcccatcccgagcatgtcgcgtgtgcctgggccgacccatggtacaactac
gcacacgaaccacccgccggacagcttcgaatcacttcagaaaagacccgagagttcaca
gtttcattgctcagcaacatcgctgagacgcttccttcgtccatgttcggcacgggtgga
gatgaaatcaatttgagatgttacctcgatgacgaacagacgaagattgagttgaaagat
gccggactctccatcgataaaaaggggcttgatcacgttttgaacgactttgtggatgca
acgcacaaagcgttgaaggaattgaagaaaacccccgtggtctgggaagaaatcgcgcta
tcccatgatttgaccagcctttcgaacgaaacaatcgtcacggtctggaccgactccagc
aaggcagccgacgcgataaataaagggttcaggatcgtccatgcgccatcgaactacttc
tacctggactgtggcggtggtggttggttgggaaactcgcctactggtaatagctggtgc
gatcctttcaagacctggcaaaaggcatatactttcgatccacaagactctatcagcccg
agtaaagcacatctagtccttggaggacagcaattgctatgggcggaacagtcatcgcca
gaaaaccttgactcgattgtgtggccacgggcagccgcatcggccgaggtgttctggaca
ggcctccacggtagcgaacgaaacctcaccgacgcactttctcggctgcacgacctccgt
taccgaatggttcagcgtaaaatccgcgcgattccacttcagccccactggtgtgctcta
cagcctgaaaaatgccttgctgctccttgggtgaaatcgtggtctatcgtccagaattcc
atcaccgagttcactcgacgattgatcaaaatcgggcggtatctgcaaggcagctacaca
ttgttcgggcgggtgatttatgagttttga

DBGET integrated database retrieval system