KEGG   Coprinopsis cinerea: CC1G_03523Help
Entry
CC1G_03523        CDS       T01275                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
cci  Coprinopsis cinerea
Brite
Exosome [BR:cci04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CC1G_03523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 145 aa AA seqDB search
MAPKPASTAGKAPASTASKAPAKSAEASKAAKKTSKPAPADGEKKKRKKVRKETYSSYIY
KVLKQVHPDTGISNKAMAILNSFVNDIFERIATEASKLASYSKKSTISSREIQTAVRLIL
PGELAKHAISEGTKSVTKFSSAGAK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcccccaaacccgcttccactgctggcaaggctcctgcctccaccgcctccaaggcc
cccgcaaagtctgcagaggcatccaaggccgctaagaagacctccaagcctgcacctgcc
gatggcgagaagaagaagcgaaagaaggtccgaaaggagacttactcttcctacatctac
aaggtcctcaagcaggtccaccccgacactggtatctccaacaaggccatggccattttg
aactcctttgtcaacgacatcttcgagcgaattgccacggaggcttccaaactcgcttct
tactccaagaagtccaccatctcgtcaagagaaatccaaactgctgtgcgcctcatcctc
cctggtgaactcgccaagcacgctatctctgagggcaccaagtcagtaaccaagttctcg
tccgctggtgccaagtaa

DBGET integrated database retrieval system