KEGG   Coprinopsis cinerea: CC1G_03633Help
Entry
CC1G_03633        CDS       T01275                                 

Definition
(RefSeq) CMGC/MAPK protein kinase
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cci  Coprinopsis cinerea
Pathway
MAPK signaling pathway - yeast
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:cci00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CC1G_03633
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    CC1G_03633
Enzymes [BR:cci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CC1G_03633
Protein kinases [BR:cci01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CC1G_03633
Chromosome [BR:cci03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     CC1G_03633
Exosome [BR:cci04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CC1G_03633
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 363 aa AA seqDB search
MSSRRNAKPLPKFEIGDDYQLLHAIGEGAYGTVAAALHKPTGRQVAIKKVLPFDHTLFCL
RTLRELKLLKFFSETCVNENIISILDIIKPPSLEEFKEIYFIQELMQTDLHRVIRTQHLT
DDHCQYFVYQTLRALKSIHSADIVHRDLKPANLLLNANCDLKVCDFGLARSVKTSVPAGK
EVGLMTEYVATRWYRAPEIMLSFKMYTKAIDIWAVGCILAELLTGRPLFPGRDYSHQLDL
ILDVIGTPSLDEFYAITSRRSRDYIRALPIRKKRPFPTLFPHASQEAIDFLTKTLTFDPK
KRMTVDEALEHPYLAAYHDPEDEPVVTPLSPDYFEFDMHKDDLSKDQLKELLYQEVLSFT
PSI
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctcgtaggaacgcaaaacctctcccaaagttcgaaatcggtgacgattatcag
ctactgcatgcgattggagaaggcgcatacgggacagtcgctgctgctcttcacaagccg
acagggcgccaggtcgccataaagaaagtcctccctttcgaccatacattgttttgcctc
cgaacccttcgagagctcaagttgctcaagttcttctcggagacttgcgtcaacgaaaat
attatttcaatcctggatattatcaagcctccttcccttgaagagttcaaggagatatac
tttatccaggaattgatgcagactgacttgcaccgtgttatccgtactcagcacctcacg
gacgaccactgccaatacttcgtttaccaaacactccgggcgctcaaatcaatccacagc
gccgacatcgtccaccgtgacctcaaacctgctaaccttcttctcaatgccaattgtgac
ctgaaggtttgtgactttggcctggctcgcagcgtgaagaccagcgtccccgccgggaaa
gaagtcggtttgatgacggagtacgtcgccactcggtggtaccgcgctcccgagatcatg
ttgtccttcaagatgtacaccaaggcaattgacatctgggctgtgggctgtattcttgcc
gaacttctcactggaaggcccttgttcccgggtcgtgattacagccatcaactcgacctg
atcctcgatgtgattggcacgcccagtctcgatgagttctatgctattacttcgcggagg
tctcgcgactatattcgtgcacttcccatccgcaagaaacgccctttccccacacttttc
ccgcacgcctcgcaggaagctatcgatttcttaaccaagaccttgacctttgatccaaag
aaacgaatgactgtggacgaggccttggagcacccttatctcgcggcttatcacgacccc
gaagatgagcctgtcgtgacaccccttagcccggactacttcgaattcgacatgcacaag
gacgatctcagcaaagaccagctgaaagagctcctctaccaggaagttttgtctttcacc
ccttctatctag

DBGET integrated database retrieval system