KEGG   Coprinopsis cinerea: CC1G_03645Help
Entry
CC1G_03645        CDS       T01275                                 

Definition
cyclin-dependent protein kinase regulator
Orthology
K06634  
cyclin H
Organism
cci  Coprinopsis cinerea
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cci00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CC1G_03645
  Replication and repair
   03420 Nucleotide excision repair
    CC1G_03645
Transcription machinery [BR:cci03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CC1G_03645
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 343 aa AA seqDB search
MAASAPEATATDAQPQQTASSSKTPLYEASTQYRNWRFSRESLAQMRASMNEAAVKAIRS
KIEANEPGSSANTTFLTPDEEVLLVKLYVAQVIAAGNKVRAQQETVSTAMSYLKRFYLRN
TVMDWHPRNVMLTCLFLATKTCNAPLSIEYFVQQFQKTEPSDVLDLEFLVAQSLSFEFSS
LPDLTIDLQESVYNAAMAQVQASRFTDAEFIYTPSQIALASLALTLPDAAKAWFNSKQSE
AHPIDWAVIEEIMNLITTEGRPPNIDTVREIDRRLKLCKNPEKVPGSKAYVAKKMLEEKR
AEERRNRKAAEAQKAIEEDPFGSDVAKPRIALVDYDDDDDDDD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgtctgcaccggaagcgacagcaacagatgcacaaccgcaacaaaccgcttcg
tcttcaaagacgcctttgtatgaggcgagcactcagtaccggaattggagattctctcga
gaaagcctcgcccagatgcgagcgtcaatgaatgaagccgctgtcaaagctattcgtagc
aagattgaggcaaacgagccaggatcctcggcaaatacgactttcctgacacccgacgag
gaggtcttgctggtcaagctctacgtggcccaggttatcgctgcgggtaacaaagttaga
gcccaacaagaaactgtgtcgacggcaatgagttatcttaaacggttctacctgaggaat
actgtcatggattggcacccccgaaacgttatgttaacttgcttgttcctcgcaaccaaa
acatgcaatgccccgttatccatcgagtatttcgttcagcaattccagaaaacggagcct
tctgatgtcctcgatctggagtttctagtcgctcagtcactgtccttcgagttctcatcc
ctccctgatttaaccatagatctccaagaatctgtgtacaatgctgcaatggctcaggta
caagcttcaaggttcaccgacgcagaattcatctacaccccatcacaaattgcactggca
agccttgccctcaccctcccagatgcagccaaggcatggttcaactccaaacaatcggaa
gctcacccaattgattgggctgtcatcgaagaaatcatgaacttgatcactacggaaggc
aggccacccaacatcgacaccgttcgcgagatcgataggcgcttgaagttgtgcaagaac
ccggagaaggtgcctggaagtaaagcctatgttgctaaaaagatgctcgaggagaagagg
gcggaggagaggaggaacagaaaggctgcggaggcccagaaagcaattgaagaggaccct
ttcggaagcgatgttgccaaaccacggatagctcttgtcgattacgatgatgacgacgac
gacgacgattaa

DBGET integrated database retrieval system