KEGG   Coprinopsis cinerea: CC1G_03682Help
Entry
CC1G_03682        CDS       T01275                                 

Definition
NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cci  Coprinopsis cinerea
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CC1G_03682
Enzymes [BR:cci01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CC1G_03682
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 361 aa AA seqDB search
MPNQYQLAFLASFFVTLASLIASLHFAVAFFRSKGYDIGDLILIGLDKKNPNPTDGRVEI
EKIPAIIMEFVKNADLDDIVQLATSPTVLVTAGIVLATAVYVKLFHTGRTAPLDPLNWKE
FPLLKTTKVSPNTAIYRFKLPHQRDVLGLPIGQHISVSAEINGKTIVRNYTPVSLDDDRG
FFDLLIKTYEKGNISRYVTTLNPGDKLRVKGPKGNFKYSPNLVGHLSMIAGGTGIAPMIQ
IIRGVLRNPLDQTTLTLIYANVNEEDILLRAELEELLDVHGEQRFKIFYVLNNPPVGWKG
GAGFVTKEHIKELLPNPAETNSKILICGPPPMVNAMKKNLDELKYPLPNTISKLQDKVFV
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaccaataccagctggcatttctcgcctctttcttcgtcactctcgcatccctc
atcgcttctctccactttgcagtcgctttcttcaggtcaaagggctacgacatcggcgat
ctcatcctaataggtctcgacaagaagaacccaaacccaacagacggacgcgtagaaata
gagaaaatacccgctatcatcatggagttcgtcaaaaacgctgacctggacgacattgtc
cagctcgccacgtcccccaccgtcctcgtcactgctggcatcgtcctcgccaccgctgtc
tatgtcaaactcttccacacaggccgaacagctcctctggaccctctcaattggaaggag
ttccccttgttgaagaccacaaaagtgtcgcctaatacggcaatctatcgtttcaagttg
ccccaccagcgcgacgtcttgggtctccccattggccagcacatctccgtctctgccgaa
attaacggcaagaccatcgtccgaaactacacccccgtcagtctcgacgacgaccgcggt
ttcttcgacctcctcatcaagacctatgagaagggcaacatctctcgctatgtcactacc
ctcaaccctggtgacaagcttcgagtcaagggtccaaagggcaatttcaagtattccccc
aaccttgttggtcacctctccatgatcgccggcggtaccggtattgcgcccatgatccag
atcatccgcggtgttttgcgaaaccccctcgaccaaactaccctcaccctcatttacgcc
aacgttaacgaagaagacatcctcctccgcgccgaattggaggaactgctcgacgtccat
ggcgaacagaggttcaagatcttctacgtcctcaacaacccacctgttggctggaagggc
ggtgctggtttcgtgaccaaggaacacatcaaggagctcttgccaaaccctgctgaaacc
aacagcaagatcctcatttgcggccctcctcccatggttaacgccatgaagaaaaacctt
gacgaactcaaataccctctcccgaataccatcagcaagctccaagacaaggtctttgtc
ttctaa

DBGET integrated database retrieval system