KEGG   Coprinopsis cinerea: CC1G_03765Help
Entry
CC1G_03765        CDS       T01275                                 

Definition
AtMMH-1
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cci  Coprinopsis cinerea
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cci00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    CC1G_03765
Enzymes [BR:cci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     CC1G_03765
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CC1G_03765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 370 aa AA seqDB search
MPELPEVQRAVNTLKHVAKGKRITKVVTYPDPIVFNATTNEEFGKELENRTVSDAKRYGK
VFYLDLDGKGKKPVLHFGMTGMLHVKGVKPMHYKEAPRKDSEDTWPPRFCKFILHLQNPT
GSSNGEPETEVAFIDARRLARIRLCTSPMEERPISELGFDPLLSMPSLETFSRTVLKRSC
PIKALLLDQSFSAGVGNWVADEVLYHARIHPEQRCNTLTTEQLKNLHHCIVYVCQTAVDV
DADHKLFPENWLFGHRWNKGKKSFSVKPLMLPSGSKATIKWITVGGRTSAYVPELQRLSP
NQSKDTKTEGESEAGESDLTSLVDSDEEEISKNKPAIQKRKAPKSTEQPARQQPARSSKR
LKGITVDGDT
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattacctgaggtacagagagcggtaaacacgctgaaacacgtcgccaaaggc
aaacggatcaccaaagtagtgacgtatccagatcctatcgtgttcaatgcgacaacgaac
gaggagtttggaaaagaacttgaaaacagaacggtgtcggatgctaagaggtacgggaag
gtattctacctagacttggatggaaaggggaagaaaccggttctgcactttgggatgact
ggaatgctccatgttaaaggcgtgaagcccatgcattacaaggaagcgccccgaaaggac
tcggaggacacgtggcctccaaggttttgcaagttcatcctgcacctccagaatcctacc
ggctcaagtaatggcgagccagaaactgaagtagcctttatcgacgcccgtaggctcgct
cgaatacgattgtgtacctctccaatggaggaacgtcccatctctgaacttgggttcgac
cctttgttatccatgccttccctcgaaaccttctcccgcacagtcttgaaacgctcatgt
cctatcaaagcgcttctccttgaccaatctttcagcgcaggagttggtaattgggtggca
gatgaagtgctctatcatgccaggatacacccagaacaacgctgcaacactttaaccact
gaacaactgaagaatttacatcactgtatcgtctatgtttgccaaactgcggtggatgtc
gatgcggaccacaaattatttccagaaaactggttgtttggtcaccgttggaacaaaggg
aagaagagtttctcggtcaaacctttgatgctgccatctggcagcaaggctaccatcaaa
tggatcacggttggcggcagaacgtctgcttatgtcccggagctgcaaagactctccccg
aatcagtccaaggatacaaagactgaaggagaatctgaagccggtgaaagcgatctgacc
tcgttggtcgattctgacgaggaggaaatttcaaaaaataaaccagctatacagaagcgc
aaggcccccaagagcaccgaacaaccagcgaggcaacagccagcacgctcctccaagaga
ttgaagggcatcaccgtcgacggcgacacctaa

DBGET integrated database retrieval system