KEGG   Coprinopsis cinerea: CC1G_03915Help
Entry
CC1G_03915        CDS       T01275                                 

Definition
cell division cycle protein 27/anaphase promoting complex subunit 3
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
cci  Coprinopsis cinerea
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cci00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CC1G_03915
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CC1G_03915
   04113 Meiosis - yeast
    CC1G_03915
Protein phosphatases and associated proteins [BR:cci01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CC1G_03915
Ubiquitin system [BR:cci04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     CC1G_03915
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 639 aa AA seqDB search
MLGPNANYVAQRFQSLVWACLDNDLVKSAVFYAERFYSQDPKNHDARHLYATALLAAKQT
YSALHLVNVSLDEQCTGCLEIKAKCCTVLGRFRQAREALDATLQDPAYISTVRSQPINAV
QTQIPRPLSSADEAGPVQKRLRSTSRQPEASSKPKSSKSTLDDPLKKARARPALSVANII
SSSSHSQPVNTSRTNTALGKSNTQPSAVPPPTRRSNRLLSGNGAKQLGLPKAPTRERRRP
VAHARTKSTANDVEEKDDEAVAGSEAVDSTSPPSALSPHSEGSPAPSGWTLLQEQQAQEE
YEIELADHAIYELVRQFASAARRLALYDCKRCLKELERLPPAHQKSASTLVMIGKVHYEL
QDYSSAERAFRSAREIEPYRLWDMEVYSTLLWHLQRNIELSYLAQELLNINPQSSQAWIA
IGNLFSLQKDRTQALTCFKRAAQLDPSCAYAFTLSGHETIDENLDVSTTFFESALRVDAR
HYNAWYGLGTCYLRASKIRRAEYHYRKALEIHPHNAVILGCVAMTLERRQEYDQALSYYN
KAIEACPENALVRYRRAKMWVSMRKYNEALKDLEHLRRTTPEEANVIFQLARVYRLIGDE
VKSAQALAVARDIAPKSLNKMKRLLETVVDEGDDKMDEG
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgctgggaccaaacgccaattacgtcgctcaacgctttcagtctctcgtctgggcatgt
ctcgacaacgacctcgtcaaatcagcagtattctacgcagaacgcttctactctcaggac
ccaaagaaccacgatgcacggcacctctatgcaacagctttgctagccgccaagcagaca
tattcggccctccacctcgtcaacgtgtcgctcgatgagcagtgcaccggatgtcttgaa
atcaaggcaaagtgctgcacagtcctcggcaggttcagacaggctagagaggcactagac
gccacattgcaggacccagcttacatctcgacagtccgctcacaacccatcaacgccgtc
caaactcaaatcccgagaccactttcatcggcagatgaggcaggtcctgttcagaaacgc
cttcgctccacctcacgacaacccgaagctagtagcaagccaaaatcgagcaagtccact
ttggacgatcccttgaaaaaggcacgcgcacgcccggccttgtcagttgctaacatcatc
tcatcttccagtcattctcagccagtgaacacttcccgaacaaacacagctcttggcaag
agtaacactcagccgagtgctgtccccccgcccacacgccgcagtaaccgcctcctgagc
gggaacggagcaaagcaactgggtctcccaaaggcccctactcgcgagcgaagacgacct
gtagcgcatgcacggactaaatcaacagcgaacgatgtcgaggaaaaggacgatgaagcc
gtggctggaagtgaagctgtcgattcgacatctccaccgtctgcactatcaccccattct
gaagggtctcctgcacccagtggctggactttactccaagaacagcaagcgcaggaagag
tacgagatcgaactagccgaccacgctatctacgagttggttcgtcagttcgcatcagcc
gcaaggcgattggctctgtacgattgcaagaggtgtctcaaagagctcgaacgattaccg
ccagcacaccagaaatctgcatcaacactggtcatgatagggaaggtgcattatgagttg
caggattactcctcggcggaacgagcgtttaggagtgctcgcgagattgagccctatcgg
ttgtgggatatggaagtgtactcgacacttttgtggcatctgcaacggaacatcgagttg
tcctacctcgcgcaagaactactcaatatcaaccctcaatcatcccaggcatggatcgcc
atcgggaatttgttctcgttgcagaaagaccggactcaagcgttgacatgcttcaagcga
gcggcccaattagacccatcgtgcgcatatgcgttcacactgagcggccacgagacgatt
gacgagaacttggacgtgtcgacgacctttttcgaatcagcgcttcgtgttgatgcgcga
cattataatgcatggtatggattgggaacatgttatttacgagcgagcaagattcgccgg
gcggaataccattacaggaaggccctcgaaatccacccacataatgccgtaatactggga
tgtgtagccatgacactggaacggcgtcaagaatacgaccaggcgctgagctactacaat
aaggcaatcgaagcatgccctgagaacgccttggttcggtatcgacgggcgaagatgtgg
gtctcgatgcggaagtacaatgaagcactaaaggacctagagcaccttcgacggacgacg
ccggaggaagcgaatgttatcttccagttggccagggtgtatcggctgattggggatgaa
gtcaagtcggcacaggcgttggctgttgcgagggacattgcgcccaagagcctgaacaag
atgaagcggctgctagagactgtggtagacgagggggacgacaagatggatgagggatga

DBGET integrated database retrieval system