KEGG   Coprinopsis cinerea: CC1G_04058Help
Entry
CC1G_04058        CDS       T01275                                 

Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
cci  Coprinopsis cinerea
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cci00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 360 aa AA seqDB search
MTSNAAELSYLSYARYGKTSVRVFRIVREGKWHHTVEYNVETLLEGDIETSYTEADNSVV
VATDSVKNITYYLAKVSPHILNAEKFALHIGTFFVSKYAHIHKAHVTVEQLRWKRISING
EEHPHSFYRDGDDKRVVKAVVDATAGKHALVANVSSGLVDLLVLKSSGSAFENFWTDEYT
TLVPVDDRIFSTSVDLSYTFKGVKLVAPQDDKKLEFQIPLNKGDEGYDGSVWDEDVPKRT
RDATLQIFALDESASVQDQATLYKMAQRIIAENGGIQDVTYTLPNKHYIPVDMRYIGVDN
LTPDVASTSVPLSVSTRPRLNSFNLCPPLLRFIFVGGPLPNVHVSRSPISSKERLPASFY
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacctccaacgctgctgaactgtcctatttgtcgtacgcgcgctatggcaagaccagt
gtccgcgtcttccggattgtccgagagggaaagtggcaccacactgtcgagtacaacgtc
gagacgctgttggagggcgacatcgagactagttacacagaagccgacaactcggtcgtc
gtcgccacagactccgtcaagaacatcacatactacctcgccaaggtctcgcctcatatc
ctcaacgcggagaaatttgctctgcacattggcacgttcttcgtgtccaagtatgcccac
atccacaaggcccatgtcaccgtggagcagctgcgttggaagaggatctccatcaacggc
gaggagcatcctcactctttctacagggatggagatgataagcgcgttgtgaaagctgtg
gtggacgccacagcaggcaaacatgccttggtagccaatgtttcttctggcctggtggat
ctccttgttctgaagtcatctgggtcggcattcgagaacttttggacggacgaatacact
accctcgtcccagtcgatgatcgcattttctctacctctgttgacctttcgtataccttc
aagggcgttaagcttgtcgcgcctcaggacgacaagaagctcgagttccaaatccctttg
aataagggagatgaaggttatgatggaagcgtctgggacgaagacgtaccgaagcgcacc
agagacgctaccctacaaatctttgctttggacgaaagtgccagtgtccaggatcaggcg
actctgtacaagatggcccagcgaattatcgccgagaatgggggtattcaagacgttacc
tatacgctccccaacaagcactacatcccagtggacatgcgctacatcggcgtagataac
ctgactccagatgtcgcgtctacctcggttccgctctctgtcagcacacgtccccgactc
aattctttcaacctttgcccgcctctgttgcgtttcatcttcgttggcggcccgttaccc
aacgttcatgtctcccgatcaccgatctcctccaaagagcgccttccggcctcattctat
tag

DBGET integrated database retrieval system