KEGG   Coprinopsis cinerea: CC1G_04058Help
Entry
CC1G_04058        CDS       T01275                                 

Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
cci  Coprinopsis cinerea
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CC1G_04058
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    CC1G_04058
Enzymes [BR:cci01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     CC1G_04058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 360 aa AA seqDB search
MTSNAAELSYLSYARYGKTSVRVFRIVREGKWHHTVEYNVETLLEGDIETSYTEADNSVV
VATDSVKNITYYLAKVSPHILNAEKFALHIGTFFVSKYAHIHKAHVTVEQLRWKRISING
EEHPHSFYRDGDDKRVVKAVVDATAGKHALVANVSSGLVDLLVLKSSGSAFENFWTDEYT
TLVPVDDRIFSTSVDLSYTFKGVKLVAPQDDKKLEFQIPLNKGDEGYDGSVWDEDVPKRT
RDATLQIFALDESASVQDQATLYKMAQRIIAENGGIQDVTYTLPNKHYIPVDMRYIGVDN
LTPDVASTSVPLSVSTRPRLNSFNLCPPLLRFIFVGGPLPNVHVSRSPISSKERLPASFY
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacctccaacgctgctgaactgtcctatttgtcgtacgcgcgctatggcaagaccagt
gtccgcgtcttccggattgtccgagagggaaagtggcaccacactgtcgagtacaacgtc
gagacgctgttggagggcgacatcgagactagttacacagaagccgacaactcggtcgtc
gtcgccacagactccgtcaagaacatcacatactacctcgccaaggtctcgcctcatatc
ctcaacgcggagaaatttgctctgcacattggcacgttcttcgtgtccaagtatgcccac
atccacaaggcccatgtcaccgtggagcagctgcgttggaagaggatctccatcaacggc
gaggagcatcctcactctttctacagggatggagatgataagcgcgttgtgaaagctgtg
gtggacgccacagcaggcaaacatgccttggtagccaatgtttcttctggcctggtggat
ctccttgttctgaagtcatctgggtcggcattcgagaacttttggacggacgaatacact
accctcgtcccagtcgatgatcgcattttctctacctctgttgacctttcgtataccttc
aagggcgttaagcttgtcgcgcctcaggacgacaagaagctcgagttccaaatccctttg
aataagggagatgaaggttatgatggaagcgtctgggacgaagacgtaccgaagcgcacc
agagacgctaccctacaaatctttgctttggacgaaagtgccagtgtccaggatcaggcg
actctgtacaagatggcccagcgaattatcgccgagaatgggggtattcaagacgttacc
tatacgctccccaacaagcactacatcccagtggacatgcgctacatcggcgtagataac
ctgactccagatgtcgcgtctacctcggttccgctctctgtcagcacacgtccccgactc
aattctttcaacctttgcccgcctctgttgcgtttcatcttcgttggcggcccgttaccc
aacgttcatgtctcccgatcaccgatctcctccaaagagcgccttccggcctcattctat
tag

DBGET integrated database retrieval system