KEGG   Coprinopsis cinerea: CC1G_04353Help
Entry
CC1G_04353        CDS       T01275                                 

Definition
phosphoribosylglycinamide formyltransferase
Orthology
K00601  
phosphoribosylglycinamide formyltransferase [EC:2.1.2.2]
Organism
cci  Coprinopsis cinerea
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cci00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cci00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 231 aa AA seqDB search
MSSTTTEMTTTKRRIVVLISGSGSNLQALIDSLDTPKLPNAEIVLVLSNRKAAYGLTRAA
QANPPIPTAYLALQPYLKNNPGKTREDYDAEVAKIVLKAKPDIVVLAGWMHILSERFLEY
LDGRKAGEEGVETPATAIPVINLHPALPGAFDGANAIQRAYEAFQKGEITHSGAMVHKVV
REVDRGQPVVVREVPIEKGEPIEAFEERLHKVEHEIIVEGTNKILEETKAR
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgacaacgacagaaatgacgacgacgaagagacgcattgtcgtgctcatctcc
ggctcaggcagcaatctccaggccttgatcgattcgctcgacaccccaaaactgcccaat
gccgagatagtgttggtgctatcgaataggaaggctgcgtacggtcttacaagagctgca
caagccaacccacccatacccactgcctacctcgcgctccagccctatctcaaaaacaac
ccaggaaagacacgggaagactacgatgcggaggttgcgaagatcgtgttgaaggcgaag
ccagatatcgtggtgttggctgggtggatgcatattctcagcgaacgtttcctcgaatat
ttggatgggaggaaagctggggaggagggtgtggagacgcctgcaacggctattcctgtt
atcaacctccaccctgccctccctggagcctttgacggtgcgaatgccatccagcgcgcc
tacgaggccttccagaagggtgagatcacccattctggagccatggttcacaaggttgtg
agggaggtcgatagagggcagccggtggtcgtgcgggaggtgccgattgagaagggagag
cctatcgaagcgtttgaagagaggctgcacaaggtcgaacacgagatcatcgtggagggg
acgaacaagattttggaagagacgaaggcacggtga

DBGET integrated database retrieval system