KEGG   Coprinopsis cinerea: CC1G_04403Help
Entry
CC1G_04403        CDS       T01275                                 

Definition
protein kinase subdomain-containing protein PKL/CAK/ChoK
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
cci  Coprinopsis cinerea
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CC1G_04403
Enzymes [BR:cci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     CC1G_04403
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 451 aa AA seqDB search
MAPVMTPILSSSLKASEELTRQLSSSSVHRLADFITRSGSSSSIVQSPASSPEVLKEEGL
PHVKKKLEPRHYKTPEFAVRLLKILSSLQVDQWSDTRVNPEDVNIRKISGALTNAVFFVS
HKTNKRVPTLLLRIYGSSSGSLISRPRELHILHKLSSVYRIGPLLYGTFENGRIEQYFKS
TTLTESDIREPTVSRWIGARMAEFHSVDIEVVSPPSDATPTGWELSVKKCVSSWMPAAHK
VLSLPGVSHAVRQELDLARFEKEWSIYVQWAAKVQDKHSGSKVVFAHNDTQYGNLLKLED
SNEVADEHRQLIVVDFEYAGPNPAAYDIANHFHEWTANYHGDTPHLLNRARYPTFAERRN
FYSAYIHHSNMLGEDPVYDKSEFEQLIAALDYQVRIWSPASHGMWAIWGIVQGREDVENG
VEEPEFDYIGYAKGRMALFRQEIVDLGVIQR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggcccccgtcatgacaccaatcttgagctcgtcgctcaaagcgagcgaggagctcaca
aggcagctttcctcgagctccgtacacaggctcgcagattttataacccgctcgggatcc
tcgtcctcgatcgtccaatcaccagccagttcccctgaagtcctcaaagaggagggtctg
cctcatgtaaagaaaaaattggagcccagacactacaaaaccccagaattcgcagttcgt
ctgctcaaaatcctctcttcgctgcaagtcgaccagtggtctgacacacgtgtcaacccg
gaagacgtcaatatccgcaagatttctggcgctctaaccaatgccgttttctttgtctcg
cacaaaacgaacaaaagagtaccaactctgcttctccggatctacgggtcctcctctggg
tcccttatctctcgcccgcgcgagttgcacatcctccacaagctttcttcagtatatcga
atcggaccactgctgtatggcacgttcgaaaacgggaggatcgagcagtacttcaaatcc
accacgctgaccgagtctgacatccgagaacccaccgtcagtcggtggatcggcgctcga
atggccgagttccattccgtcgatattgaggtcgtcagtcctccttcggacgccacacca
accggttgggagctcagtgtgaagaaatgtgtgtcatcgtggatgcctgctgcgcacaaa
gtactctcattgcccggtgtaagccatgctgtacgtcaggagcttgacttggctcgtttc
gagaaggaatggagcatctacgtgcaatgggctgccaaggttcaggacaaacactctggt
agcaaggtggtctttgcccacaacgatactcaatacgggaacctgctaaaacttgaagac
tcgaatgaagtcgcagacgaacatcgtcagttgatcgtggtggactttgaatacgcaggt
ccgaacccagcagcctacgacatcgccaaccacttccacgaatggacagccaactaccac
ggcgacaccccgcacctcctcaatcgcgcacgctaccccacctttgccgaacgccgcaac
ttttacagcgcatacatccaccactcgaacatgctcggcgaggatcccgtgtacgataaa
tccgagtttgagcagctcattgctgctttggattatcaagtccggatttggagtcccgca
tcgcatgggatgtgggcgatttgggggatcgtacagggtcgtgaggatgttgagaatgga
gtggaggaacccgagtttgattatattgggtatgcaaagggtcggatggcgttgttccgc
caggaaatcgtggatctcggtgtcatccagcggtag

DBGET integrated database retrieval system