KEGG   Coprinopsis cinerea: CC1G_04427Help
Entry
CC1G_04427        CDS       T01275                                 

Definition
histone deacetylase Hda1
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cci  Coprinopsis cinerea
Brite
Enzymes [BR:cci01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CC1G_04427
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 590 aa AA seqDB search
MGDKWTPVEGESQKKRVCYFYDSDIGGFHYGPGHPMKPTRIRMCHSLVMNYGLYKKMEIF
RAKPATKREMTQFHSDEYVEFLSKITPNNMNSFVKEQHKYNVGDDCPVFDGLFEYCSISA
GGSMEGAARLSRDKCDIAINWAGGLHHAKKSEASGFCYVNDIVLGILELLRYHNRVLYID
IDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGELRDVGIMKGKYYSLNFPLRDGISD
ENYKSVFEPVIRSVMETYDPSAIVLQCGTDSLSGDKLGCLNLSMKGHANCVKFVKSFNKP
LLLLGGGGYTMRNVSRAWAYETGLAAGVELNPEIPVNEYYEYFGPDYQLDVKSSNTDDLN
TPAYLDRVKRIVLENLRHTQGPPSVQMTDIPSMPIDADIDDPNQDEDMVDPNDRRPMRLL
DSRRQADGELSDSDDEGEGGRRDIASHKDRESNGEGAGHKFGMGVGIMASSSAATHGAGP
SGHTTAAQILSAPKADAPMDVDTPTSETGSAPVTEGKSSEVNGGGGASAGAVAASAGPSS
ASGQPAAPAAEPAKEDKDTAMAVEEPSEPKPSEPASSTAAAAPAPTTSTT
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacaaatggacaccagttgaaggcgaaagccagaagaaacgagtttgctacttt
tacgattctgatattggcgggttccattatggacctggtcatccgatgaaacctactcga
atccggatgtgccattcgttggtcatgaactatggtttatacaagaagatggaaatcttt
cgcgccaaaccagcaactaaacgcgaaatgacccaattccattcggacgagtatgtcgag
ttcttgagcaagatcacccccaacaacatgaactcgtttgtcaaagaacaacacaaatat
aatgtgggagacgactgtcctgtattcgatggtctatttgaatactgctcgatatccgct
ggtggctctatggagggtgctgcgcgtctgagccgtgacaaatgtgatattgctatcaac
tgggctggaggactgcaccacgcaaagaagagcgaggccagtgggttctgctacgtaaat
gacattgtactcggtatcctggagcttttgaggtaccacaaccgagtgctctacatcgat
atcgacgtccaccacggagatggtgtagaggaggcattctataccactgaccgggtgatg
actgtcagtttccacaagtacggcgaatacttccctggaactggtgaactacgcgatgtt
ggaattatgaaaggaaaatactattccctcaacttcccattacgagatggtatctcggac
gagaactacaaatctgtcttcgaaccggtaattcgctcggtgatggaaacctacgatccc
tctgctattgtcctccaatgtggaacggattctctgtccggagacaaactcggctgcctc
aacctctccatgaaaggccacgccaactgcgtaaagtttgtcaaatcgttcaacaagcct
ctcttgctccttggtggtggtggatacacgatgcgtaatgtcagtcgtgcatgggcgtat
gagactggtctagctgctggtgtcgagcttaaccctgaaattcccgtaaacgaatactac
gagtatttcggcccagactaccaactggatgttaaatcctcaaatacggacgacctcaat
accccggcctaccttgatagagtgaagcggatagtgttggagaatctgcgacatacgcag
ggacctcccagtgtgcagatgaccgatatcccctccatgccaatcgacgccgacattgat
gaccccaaccaggacgaagatatggtggaccccaatgaccgccgaccaatgcgactattg
gattcgcgacggcaagcggatggggagctgtcagactctgatgacgaaggagaaggaggt
cgacgggatatcgcttcccacaaggatcgtgaatccaatggagagggagcaggccataaa
ttcggaatgggggttggcatcatggcttcttcgtctgcggcaacccatggagctgggcct
agtggtcatacgactgctgcacaaatcctatctgctccaaaggctgatgcacctatggac
gttgacaccccgacgtccgagactggtagcgcccctgtaaccgagggaaagagtagtgaa
gtgaacggcggtggaggggcttctgctggtgccgtcgccgcttctgctggcccctcttct
gcatccggacaacctgcagcaccagcggctgagccagctaaggaggacaaggatacggct
atggctgttgaagagcccagtgagcctaagccctctgagccagcgtcatcgacagccgct
gctgctcctgctcctaccacttctacgacctga

DBGET integrated database retrieval system