KEGG   Coprinopsis cinerea: CC1G_04466Help
Entry
CC1G_04466        CDS       T01275                                 

Definition
AGC/PKA protein kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cci  Coprinopsis cinerea
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cci00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CC1G_04466
Enzymes [BR:cci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CC1G_04466
Protein kinases [BR:cci01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CC1G_04466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 423 aa AA seqDB search
MIKRMAGKLTAHIGGHHNGKGFLGATGLTPSSPSEAMYPDTTTLPTIPMAVSSLEHRDSI
STERTSTSMGDESVAGGRFGIEAPRFSARPQRPKGTYRLSDFSIQRTLGTGSFGRVHLVR
SKHNGRFYAIKVLNKERIVRMKQIEHTNNEMKMLESVQHPFIINLWGSFQDSSNLYMVMD
FVPGGELFTLLRRSNRFPDPVAKFYAAEVALALNYMHSLDIVYRDLKPENILLNVDGHIK
IADFGFAKLCATTTWTLCGTPDYLAPEIVSQQRYNKSVDWYALGVLIFEMLSGLPPYHQP
EPNHLALYEKIMRGPKNIRWPAAAFNENATDLILKLMEGDPSRRYGNLRHGAGDVFAHPW
FREVDWDRLAAREITAPYLPRISGDGDASAFDKYPEDNVQNTYGLPALDPYGVVFPDFEY
TGS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaacgcatggcaggcaagcttactgcgcacattggcggtcatcataacggcaag
ggcttcctgggcgcaactggtttgaccccttcatcaccgtccgaagcgatgtacccagac
acgacgacattacccacgataccgatggccgtctcgtctctggaacatcgcgactcgata
tcaacagagcgaacctcgaccagcatgggagacgagagcgtcgcgggtgggcgcttcggt
atcgaggcacctaggttctctgcgcgcccacagcgaccgaaggggacataccgactctca
gactttagtatccaacggacgttaggaacgggcagctttggtcgggtacatctagtgcgg
agtaaacacaatggtcgcttctacgccatcaaggtcctcaacaaagagagaatcgtcagg
atgaagcaaatcgaacacacgaataacgagatgaagatgctcgagtctgtgcagcacccg
tttataatcaacctttggggttcgttccaggactctagcaatctgtatatggttatggat
ttcgtgccgggaggagagctgtttacacttctgagaaggtcaaatcgcttccccgacccc
gttgccaagttctatgccgccgaggtggcgctagcgctcaactacatgcattcgctggac
atagtctatcgagatctgaagcccgaaaacattctgctcaatgtcgacggacatatcaag
attgctgactttggatttgccaaactttgtgcgacaacgacatggacactgtgcgggaca
cccgactacctagcacccgagattgtcagccagcaacggtacaacaagagtgtcgactgg
tatgcgctcggcgtgttgatcttcgagatgctgtcagggctaccgccatatcaccaaccc
gaacccaaccaccttgcgctatacgagaagattatgcgtgggcccaaaaacatcagatgg
ccagcagcagcctttaatgagaacgcgacggatctcatcttgaagctcatggaaggcgat
ccatcacggcggtatggaaacctgcggcatggcgctggtgatgtctttgcgcatccgtgg
ttcagagaggtcgattgggatcgacttgctgctagggagatcaccgcaccgtatctgccc
cgaatcagtggcgatggcgatgctagcgcattcgacaaataccctgaagacaatgtccaa
aacacctacggcctaccagccttggacccttatggggtcgtcttccctgattttgaatat
accggctcatag

DBGET integrated database retrieval system