KEGG   Coprinopsis cinerea: CC1G_04534Help
Entry
CC1G_04534        CDS       T01275                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cci  Coprinopsis cinerea
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cci00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cci00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cci00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cci00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 504 aa AA seqDB search
MSASLMPRSDSFNARVRGTSHIDFKTATTGVAAKSMRNEISRLVSTVEDPATKKAFDTEM
QSFFYLFTRYLSERAKSVELDWDRIKSPAADQIIPYSDLPSPSDTKNLDKLAVLKVNGGL
GTSMGMTGAKSALEVKDDMTFLDLTVRQIEHLNTTNRVDVPLILMTSFNTHEDTLRIIKK
YANQQLRITTFNQSRYPRIYKESLLPCPKRADDDKSHWYPPGHGDLYNALLHSGVLDQLL
AEGKEYLFVSNSDNLGAVVDEKILQHMIDTKAEFLMEVTDKTKADVKGGTLIDYEGSIRL
LEIAQVPSEHVEDFKSVRKFKIFNTNNLWINLKALKRVMENEGLELDIIVNPKITDEGHA
VIQLETAAGAAIKHFKNAHGVNVPRSRFLPVKSCSDLLLIKSDIYSLQHGQLVINPQRMF
ETTPVIKLGDHFKKIQQFQKRFKKIPKILELDHLTVTGDVYFGRNVTLRGTVIVVANEGQ
RIDIPDGCVLENRLLSGNLNMIEL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcctcccttatgccccgcagcgactccttcaatgcccgtgttcgaggcacaagt
cacatcgacttcaagaccgccaccaccggtgtcgcagcgaagtcgatgaggaacgagatc
agccgtctcgtgtccaccgtcgaggatcctgcaaccaagaaggctttcgacactgagatg
cagtcgttcttctacctcttcacgcgatacctctccgaacgcgcaaagagcgtcgagctt
gattgggaccgcatcaagtcccccgctgctgatcagatcatcccctactctgacctgcca
tcgccctcagacaccaagaacctcgacaaactcgctgttctcaaggtcaatggtggtctc
ggaacttccatgggcatgaccggtgcgaagagtgctctcgaggtcaaggacgacatgacc
ttcctcgacttgactgtccgacagatcgagcatctcaacaccaccaaccgcgtcgatgtc
cccctcattctcatgacttcattcaacactcacgaggacaccctccgcattatcaagaag
tacgctaaccagcagcttcgcattactaccttcaaccaatctcgatacccccgaatctac
aaagagagtttgcttccttgccccaaacgtgctgatgacgacaagagccactggtaccca
cccggccacggtgacttgtacaacgctctcttgcactctggtgtcctcgatcagctgctt
gccgagggcaaggagtacctcttcgtttccaactcagacaacttgggcgccgtcgttgac
gagaagatcctgcaacacatgattgatacaaaggcggagttcttgatggaagtcaccgac
aagaccaaagccgacgttaagggtggaaccctcatcgattatgaaggctctattcggttg
ctcgaaattgcccaagttccttccgagcacgtcgaggacttcaagtctgttcgcaagttc
aagatcttcaacaccaacaacttgtggatcaacttgaaggccctcaagcgggtcatggag
aacgaaggccttgagcttgacattattgttaaccccaagatcactgacgagggtcatgcc
gtcattcaacttgagactgctgccggcgccgccatcaagcacttcaagaatgctcatggt
gtcaatgttcctcgaagccgcttcttgccggtgaagagttgctctgacttgctcctcatc
aagagcgacatctattctctccaacatggacaactcgtcatcaaccctcaaaggatgttc
gagaccacccccgtcatcaagctcggtgaccacttcaagaagatccaacaattccagaag
agattcaagaagattcccaagatcttggagcttgaccacttgactgtgactggcgatgtc
tactttggccgtaacgtcactcttcgtggtaccgtcattgtcgtcgccaacgagggtcag
cgaatcgacattcctgacggctgcgtcttggagaacagactgctctctggtaacctcaac
atgattgaactctaa

DBGET integrated database retrieval system