KEGG   Coprinopsis cinerea: CC1G_04534Help
Entry
CC1G_04534        CDS       T01275                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cci  Coprinopsis cinerea
Pathway
cci00040  Pentose and glucuronate interconversions
cci00052  Galactose metabolism
cci00500  Starch and sucrose metabolism
cci00520  Amino sugar and nucleotide sugar metabolism
cci01100  Metabolic pathways
cci01130  Biosynthesis of antibiotics
Module
cci_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CC1G_04534
   00052 Galactose metabolism
    CC1G_04534
   00500 Starch and sucrose metabolism
    CC1G_04534
   00520 Amino sugar and nucleotide sugar metabolism
    CC1G_04534
Enzymes [BR:cci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CC1G_04534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 6006539
NCBI-ProteinID: XP_001830101
UniProt: A8N5F6
Position
3
AA seq 504 aa AA seqDB search
MSASLMPRSDSFNARVRGTSHIDFKTATTGVAAKSMRNEISRLVSTVEDPATKKAFDTEM
QSFFYLFTRYLSERAKSVELDWDRIKSPAADQIIPYSDLPSPSDTKNLDKLAVLKVNGGL
GTSMGMTGAKSALEVKDDMTFLDLTVRQIEHLNTTNRVDVPLILMTSFNTHEDTLRIIKK
YANQQLRITTFNQSRYPRIYKESLLPCPKRADDDKSHWYPPGHGDLYNALLHSGVLDQLL
AEGKEYLFVSNSDNLGAVVDEKILQHMIDTKAEFLMEVTDKTKADVKGGTLIDYEGSIRL
LEIAQVPSEHVEDFKSVRKFKIFNTNNLWINLKALKRVMENEGLELDIIVNPKITDEGHA
VIQLETAAGAAIKHFKNAHGVNVPRSRFLPVKSCSDLLLIKSDIYSLQHGQLVINPQRMF
ETTPVIKLGDHFKKIQQFQKRFKKIPKILELDHLTVTGDVYFGRNVTLRGTVIVVANEGQ
RIDIPDGCVLENRLLSGNLNMIEL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcctcccttatgccccgcagcgactccttcaatgcccgtgttcgaggcacaagt
cacatcgacttcaagaccgccaccaccggtgtcgcagcgaagtcgatgaggaacgagatc
agccgtctcgtgtccaccgtcgaggatcctgcaaccaagaaggctttcgacactgagatg
cagtcgttcttctacctcttcacgcgatacctctccgaacgcgcaaagagcgtcgagctt
gattgggaccgcatcaagtcccccgctgctgatcagatcatcccctactctgacctgcca
tcgccctcagacaccaagaacctcgacaaactcgctgttctcaaggtcaatggtggtctc
ggaacttccatgggcatgaccggtgcgaagagtgctctcgaggtcaaggacgacatgacc
ttcctcgacttgactgtccgacagatcgagcatctcaacaccaccaaccgcgtcgatgtc
cccctcattctcatgacttcattcaacactcacgaggacaccctccgcattatcaagaag
tacgctaaccagcagcttcgcattactaccttcaaccaatctcgatacccccgaatctac
aaagagagtttgcttccttgccccaaacgtgctgatgacgacaagagccactggtaccca
cccggccacggtgacttgtacaacgctctcttgcactctggtgtcctcgatcagctgctt
gccgagggcaaggagtacctcttcgtttccaactcagacaacttgggcgccgtcgttgac
gagaagatcctgcaacacatgattgatacaaaggcggagttcttgatggaagtcaccgac
aagaccaaagccgacgttaagggtggaaccctcatcgattatgaaggctctattcggttg
ctcgaaattgcccaagttccttccgagcacgtcgaggacttcaagtctgttcgcaagttc
aagatcttcaacaccaacaacttgtggatcaacttgaaggccctcaagcgggtcatggag
aacgaaggccttgagcttgacattattgttaaccccaagatcactgacgagggtcatgcc
gtcattcaacttgagactgctgccggcgccgccatcaagcacttcaagaatgctcatggt
gtcaatgttcctcgaagccgcttcttgccggtgaagagttgctctgacttgctcctcatc
aagagcgacatctattctctccaacatggacaactcgtcatcaaccctcaaaggatgttc
gagaccacccccgtcatcaagctcggtgaccacttcaagaagatccaacaattccagaag
agattcaagaagattcccaagatcttggagcttgaccacttgactgtgactggcgatgtc
tactttggccgtaacgtcactcttcgtggtaccgtcattgtcgtcgccaacgagggtcag
cgaatcgacattcctgacggctgcgtcttggagaacagactgctctctggtaacctcaac
atgattgaactctaa

DBGET integrated database retrieval system