KEGG   Coprinopsis cinerea: CC1G_04997Help
Entry
CC1G_04997        CDS       T01275                                 

Definition
glucoamylase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
cci  Coprinopsis cinerea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CC1G_04997
Enzymes [BR:cci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CC1G_04997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 581 aa AA seqDB search
MRSLLFTTFLGLFSTVTNARSDPIAIADAYFERQVPIATENLLANIGPDGARSSGALPGV
VIASPSTEDPDYLYTWTRDASLVMKNVIDRYLRDEDDSLQSIVEDFIPAQAYLQQLDNPS
GNVTTGGLGEPKFNIDLTPFTGSWGRPQRDGPPLRAIAIIRYANHLLDTGKPFVVLEFVW
PVIKLDLDYTAKYWNTTGFDLWEEVSSSSFFTSAIQHRALMEGAAFASRIGQPDLARSYF
KQADNILCFLQACVSYWNPSEGFITSNTGGGRTGIDANSILGSIHTFDPAAGCDPVTFQP
CSDKALSNLKVYVDAFRSIYPINYGTPTNQAVATGRYAEDVYYGGHPWYLTTAAAAQQLY
DALMVWDMQGYLKVSSISLAFFRQFDDSVQPGTYSNSSETYRILKNAVRWFADEFIEVIA
RYTPEDGSLAEQFHRETGEPLSAKHLTWSYASILTADAARSGVIPRSWGASGLEVPSKCE
SNAVPMSSVTFSVKAQTSWGENIFLTGSIDALKNWSPDNALALSSSDYPIWKVTVEIPVD
TRFEYKYIRKLGDGSVIWESDPNRSNSSPGSGSKTIDDSWR
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccttactcttcacgacgttcctaggcctcttttcgactgtaacaaacgccaga
tccgaccccatagccatcgccgacgcctactttgaaaggcaggttccaatcgccaccgag
aatttgctggcgaatattggacccgacggtgcgaggtcttcaggcgctttgccgggagtc
gtaatcgcaagccccagcactgaagatccggactatctctacacatggacgagggacgct
tcgttggttatgaagaacgtcatcgacagatatcttcgggacgaggacgactccctccaa
tcgatagttgaggacttcattccagcccaagcgtaccttcagcaactagacaaccccagt
ggaaacgtcacgaccggaggattgggggaaccgaaatttaacatcgatttgacgccattc
actggtagctggggaaggcctcagagggacggccctcctcttcgcgctatcgcgattata
cgctacgcaaatcacctacttgacaccgggaagccattcgtagttctggaattcgtatgg
cctgtcattaagctggacctcgactatactgcaaagtattggaacacgacaggtttcgac
ctctgggaagaagtatcttcaagttcattcttcacgtctgccatccagcatcgcgccctc
atggaaggtgccgctttcgcaagtcggatcggacagcccgacctagcgcgatcctacttc
aaacaggccgacaacattctctgtttcctccaggcatgtgtatcgtattggaatccttct
gaaggcttcatcacctcgaatacgggaggtggccgaaccggaatcgatgccaactctatc
ttaggatcgattcatactttcgacccggccgctggatgcgacccggtcaccttccagcca
tgctccgacaaggcgttatccaacctcaaggtttacgtcgacgccttccggtcgatctac
cctatcaactatggcactcccaccaatcaggccgtggcaactggccgctatgctgaagac
gtctactacggtggtcatccgtggtacttgactactgcagccgccgctcagcaactgtac
gatgccctgatggtttgggatatgcaaggctacctcaaagtctcatcaatatctctggcc
ttcttccggcagttcgacgattccgttcaaccaggaacctactcaaactcttcagagacg
tacaggatccttaagaacgccgtcagatggttcgccgatgaattcattgaagtcatcgcc
aggtacaccccagaagacggaagtttggccgagcagtttcatcgggagactggcgagcct
cttagcgccaaacacttgacatggagctatgcgtccatcctaactgctgacgctgctcgg
tcgggtgtcatccctcggagctggggagctagtggcttggaggttccttcgaaatgcgaa
agtaacgctgtcccgatgtcgagcgtcacgttcagcgtgaaggcacagacctcatgggga
gaaaacatcttcctgaccggttctatcgacgctctgaagaactggtccccagacaacgcc
ctggcactttcttcatcggactatcccatctggaaggtcaccgtcgagatacctgttgac
acgagattcgagtacaagtacattcgcaagttaggggatgggagcgtgatttgggagtcg
gatcccaatcggtcgaactcgagccctgggtctgggtccaagacgattgatgattcgtgg
aggtag

DBGET integrated database retrieval system